Conserved Protein Domain Family
COG4

?
pfam08318: COG4 
COG4 transport protein
This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi an intra Golgi transport.
Statistics
?
PSSM-Id: 400560
View PSSM: pfam08318
Aligned: 115 rows
Threshold Bit Score: 190.49
Threshold Setting Gi: 74831328
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERS99807     226 EEARASLCGLFLREFERAAQDGDDARVTRFFKLFPLIGRTDVGLDVYGRYVCQGVAESARNVFRGETPQpaavpaaasrH 305  Sporothrix sch...
EFJ37060     155 lESKRKLEEVIKKRFYAAVDARDHAGVVRFASLFAPLGLHEEGIKAYVSYLRRSVDHRARDGFAAVKETp---------- 224  Selaginella mo...
KRH68961     185 lAAKKQLEGIVRKKLSAAVDQRDHPAILRFIRLFTPLGVEEEGLQVYVGYLKKVIAMRSRMEFEQLVEMmd--------q 256  soybean
Q8L838       177 HASKEQLEGIAKKKLLAAIDQRDHPTILRFVRLYSPLGMETEGLQLYVGYLKKVIALRGRMEYENVVELmeq------gl 250  thale cress
XP_004243228 173 lASKKQLEGIVRRKLAEAVDQRDHSTVLRFIRLYPPLALEEEGLQVYVMYLKKVIAMRSRLEYEQLVEMmsdq--qgssQ 250  tomato
ERM93568     180 lESKRQLESIVRKKLSAAVDQQTHGEILRFVRIFPMLGLRAEGLQIYVSYLRKVISMRTRMEFDTVKEFidq----srpP 255  Amborella tric...
XP_002468432 191 lDIKRRLEGLARRRLAAVIDAQDHPAVLRLVRLFPLLGLADEGLQVYVAYLKKVVALRARADFEHLAELtsat---qptS 267  sorghum
EFC48634     119 KKSEKKIKEIVSSKMKEALRDENETQIKRFSKLFSPLCMNEDGLSLY----VDFLSDKCRKELESLDEVerltyirkqqQ 194  Naegleria gruberi
Q4DDH2       242 ASARESAREKLLEKFRVASRSNDKLTIMQATRLLTQLGFSEEGCSLYCTWLCEHTIAALKKMVDRELRKmdd-----ptE 316  Trypanosoma cruzi
CBI38713     145 mASKKQLEGIVRKRLAAAVDQRDHPTILRFVRLFSPLNLEEEGLQMYVNYLKKVIGMRSRLEYEHLVELmeqs---sgnQ 221  wine grape
ERS99807     306 DGFFFANALAKLFTHISQIVEGHGALVERHYGGGQMIK-VISRLQKEADVQGGIVVDAWSDERGVDRKLTDVKSYPFSfl 384  Sporothrix sch...
EFJ37060     225 DQADFVAALNNIFKDIAEAIEENEELLKSLNGEDGLVY-AIRELQEECDSRGSAIVKKYMEFRGLAKLEKEIIAQTNaek 303  Selaginella mo...
KRH68961     257 QNVNFVGCLTNLFKDIVLAIEENSEILSGLCGEDGIVY-AICELQEECDSRGSVILNKYMEYRQLAKLSSEINAHNTn-- 333  soybean
Q8L838       251 GQVNFVGCLTNLFKDIVMAIEENDEILRGLCGEDGVAY-AICELQEECDLRGSLILKKYMDFRKLAILASDINNSPNl-- 327  thale cress
XP_004243228 251 NQLNFVSCLTNLFKDIVLAIEENDETLRSLCGEDGIVY-AICELQEECDSRGSTIIKKYMEYRKLAKVTSEINSYKS--- 326  tomato
ERM93568     256 SEINFVNCLTSLFKDIVLAVEENDAVLRELCMEDGVVY-AICELQEECDLWGTTIMKKYMEFRKLGKITADINSYSK--- 331  Amborella tric...
XP_002468432 268 ERLDFVGCLTRLFKDIVLAVEENDAVLRELRGDDGVAY-AIIELQEECDSRGTQILRRYADYRKLARLASDINSYTKnll 346  sorghum
EFC48634     195 QYVSFIDIITQILDIIVSYIEDCEDFVTSNFGGEKCTIyLINSLQHVCDKMVKKVLDVYEKKRELNDILTAVSKKPN--- 271  Naegleria gruberi
Q4DDH2       317 AGMSHLGLVSTVLDAVVAAFENEEEFIRETFGDAGLLK-LLTELHCKSTSQCVPVLKDFLKKRQE--VLSSVTSAGGInt 393  Trypanosoma cruzi
CBI38713     222 SNVNFVGCLTNLFKDIVLAVQENSEILRSLCGEDGIVY-AICELQEECDSRGSSILKKYLDYRKLARLTSEINSYKN--- 297  wine grape
ERS99807     385 vqsfgmkgaggsssnsnaggggggdgASrvnsp---algvdSPRRSEDEGGVNMREIDGLLNEIAIMLSRWSLYSRFLAN 461  Sporothrix sch...
EFJ37060     304 div---------------------------------aqsklLMSAGGAAEGPDLRSIEMFLEEILLLIQTSEDYTQYMIG 350  Selaginella mo...
KRH68961     334 -----------------------------------------LLAVGGGPEGPDPREVELYLEEILNLMQLGEDYTEFMIS 372  soybean
Q8L838       328 -----------------------------------------NILPGGASEGPDPREVELYVEEILSLMQLGEDYTEFMVS 366  thale cress
XP_004243228 327 ------------------------------------------DLLSVGIEGPDPRDIEVYLEEILSLTQLGEDYTGYMIS 364  tomato
ERM93568     332 -----------------------------------------NLLSVGVLEGPDPREIEMYLEEILALTQLGEDYTEFMVS 370  Amborella tric...
XP_002468432 347 s------------------------------------amgsMASAAGGNEGPDPREIELYLEEILALTQLGEDYTEFMVN 390  sorghum
EFC48634     272 -----------------------------------------TLPIKKDLNTNDPRVLDLILEEIAEISSNIEVYKQFIAG 310  Naegleria gruberi
Q4DDH2       394 nsssss-------------sgnargqFPagsveaaagspvfPTTSSAVAATVDPRRTDQILEEMSHLVSCCHLYWTFAQS 460  Trypanosoma cruzi
CBI38713     298 ------------------------------------------RLSVGAAEGPDPREIELYLEEILSLMQLGEDYTEFMVS 335  wine grape
ERS99807     462 KCrddeaeaaaqaeadakdtkkeksgkdgqdgqdskdssterATAA-----TPDERPLVIPSVLAQSN---LQRKVaARL 533  Sporothrix sch...
EFJ37060     351 RVr---------------------------------------EAGS-----SGAQLSPRSTTSFKVGS---FYRAV-QEL 382  Selaginella mo...
KRH68961     373 KIk---------------------------------------ALTS-----VDPELLPRATKAFRSGS---FSKVA-QDL 404  soybean
Q8L838       367 KIk---------------------------------------SLTS-----VDPELLPTATKAFRNKS---FSKAI-QDV 398  thale cress
XP_004243228 365 KIr---------------------------------------GLSS-----VDPELGPRATKAFRSGN---FSKVV-QDI 396  tomato
ERM93568     371 KIg---------------------------------------GMAA-----LDPQLAPRATKAFRSGS---FSIMA-QEL 402  Amborella tric...
XP_002468432 391 KIr---------------------------------------GLRD-----VKPELGPRAMKAFRNGN---FNKME-QDL 422  sorghum
EFC48634     311 KCi-----------------------------------------------nIKTDGKNEMYTLTKEPI---IYRRI-QEL 339  Naegleria gruberi
Q4DDH2       461 KQqe------------------------------------ymHGVEatgkqHEQQEVVVSVDSLWSSRdnpLMNTV-QEI 503  Trypanosoma cruzi
CBI38713     336 TIk---------------------------------------GLSS-----VDPELGPRATKAFRNGN---FSRSI-QDI 367  wine grape
ERS99807     534 ITPYSLMSTFFFRRSVEKAF--QLEETPGdlsl----------------------------------------------- 564  Sporothrix sch...
EFJ37060     383 TSHYRLLEEYFMAENVRKAI--KLDEFP---------------------------------------------------- 408  Selaginella mo...
KRH68961     405 TGFYVILEGFFMVENVRKAI--KIDEQV---------------------------------------------------- 430  soybean
Q8L838       399 TRYYVILEGFFMVENVRKAI--RIDEHV---------------------------------------------------- 424  thale cress
XP_004243228 397 TGYYVILEGYFMVENVRKAI--KIDELV---------------------------------------------------- 422  tomato
ERM93568     403 SGYYVILEEFFMVENVRKAI--RIDEHV---------------------------------------------------- 428  Amborella tric...
XP_002468432 423 TGFYVIFEEFFMVENVRKAI--RIDEPI---------------------------------------------------- 448  sorghum
EFC48634     340 MSFYIPIDMSFMKQSFFKAI--QLESDED--------------------------------------------------- 366  Naegleria gruberi
Q4DDH2       504 LGVFVPLQTLYFEAAFEQALrlQMDALHAaarealmsgtegggdlsarkrtgvivhssshhhhhhqsskknetysspsak 583  Trypanosoma cruzi
CBI38713     368 TGYYVILEGFFMVENVRKAI--NIDEHV---------------------------------------------------- 393  wine grape
ERS99807     565 ----------------nmadAl-------dNNPPYIISAVDDVMYIVNAVIQKCMSTLQRDVVVGVIPPVGRVLGSDFIG 621  Sporothrix sch...
EFJ37060     409 -------------------------------ANSLTTSVVDDVFYVLQSCTRRAVSTSNVHLTLSIVTCAANLLGNEYKD 457  Selaginella mo...
KRH68961     431 -------------------------------PDSLTTSMVDDVFYVLQSCLRRAISTSNISSVVAVLSGASSLLGNEYHE 479  soybean
Q8L838       425 -------------------------------PDSLTTSMVDDVFYVLQSCLRRAISTSNISSVIAVLSYAGSLLGNDYHE 473  thale cress
XP_004243228 423 -------------------------------FDSLTTSMVDDVFYVLQSCCRRSISTSNINSVIAVLSSAVSLLGGEFNE 471  tomato
ERM93568     429 -------------------------------PDSLTTSMVDDVFYVLQSCCRRAISTSKVNSVLAVLSGAVNLLSNEYQE 477  Amborella tric...
XP_002468432 449 -------------------------------PDGLTTSMVDDVFFVLQSCCRRAASTASINSVLAVLGGATSLLSNEYQE 497  sorghum
EFC48634     367 --------------------E---------DESSKYSSIINDVFFILQKSLSRAMDSQNVSVVCAIVNHINGILATDYFE 417  Naegleria gruberi
Q4DDH2       584 ktanfmtglaalytstaaasGgedeempdaAMDQVSITLPDDVFFFLRIALHRAVNTKSTQIISAVFIACIELVQSKLLp 663  Trypanosoma cruzi
CBI38713     394 -------------------------------PDSLTTSMVDDVFYVLQSCLRRAISTSNINSVLALLSGSISLLGNEYQE 442  wine grape
ERS99807     622 MIQRKM 627  Sporothrix schenckii ATCC 58251
EFJ37060     458 ALQRKM 463  Selaginella moellendorffii
KRH68961     480 ALQHKT 485  soybean
Q8L838       474 ALQQKI 479  thale cress
XP_004243228 472 ALQQKV 477  tomato
ERM93568     478 ALQRKM 483  Amborella trichopoda
XP_002468432 498 ALQWRM 503  sorghum
EFC48634     418 FVKKDv 423  Naegleria gruberi
Q4DDH2       664 vlqlqt 669  Trypanosoma cruzi
CBI38713     443 ALQQKM 448  wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap