Conserved Protein Domain Family
Sin3_corepress

?
pfam08295: Sin3_corepress 
Sin3 family co-repressor
This domain is found on transcriptional regulators. It forms interactions with histone deacetylases.
Statistics
?
PSSM-Id: 400545
View PSSM: pfam08295
Aligned: 92 rows
Threshold Bit Score: 91.888
Threshold Setting Gi: 484856451
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESN99563      737 KQYGKHYRELPKNYIQETCSGQTELE---EEVLNSTYVLFPvsggDEendrASNDDddDDVScRRNPLEDHVFQCEDERY 813  Helobdella ro...
ESN92146      559 KRYDISYLSLPKDHIHARCSGRTAMC---YEVLNDTHVSFP----SW-----SEDs--SSVI-KKTMAEEMIFRCEEERY 623  Helobdella ro...
1_pfamImport    1 KRIGSSYRALPKTYQQPRASSLLAPG---GKCLKETW-GVPfp------lrGPEGLppFRAApKKTPLSRSKLV---PLV 67  
XP_004987881  757 LQVEVSYRRLPDEFQHAQCSGRKNMDpslLETLNNRYVSFP----SW----TSEDNq-FVTG-KKTQYEDNLFKAEDERF 826  Salpingoeca r...
XP_001743653  926 DRLDQSYRLLPTTHQKLRCSGRRHLEpniAKVLNDKYVSFP----VW----TSEDSs-FVAS-KKNAHEEALFRCEDERF 995  Monosiga brev...
XP_003114860  864 cTLGPSYRLLKGGARGKETFGRIDMSrdvQGVLNDKWTSYP----SW----SSEDTgsQTV--KKSNLEEFHFKTEEERY 933  Caenorhabditi...
EGT52598      857 cTIGPSYRLLKDT-KPVECSGRNELDpeiKATLNDKWMSYP----SW----SSEDVgtQAI--KKTNLEEFHTKTEEERY 925  Caenorhabditi...
A5JYW9        799 cTLGPSYRFMKDT-KATDCSGRVELDddlKGVLNDTWTSIP----SW----SSEDTg-SQAI-KKSNLEEFHFKTEDERY 867  Caenorhabditi...
8_pfamImport    1 -TLGPSYRLMKDM-KSEACEGRIEMDpelKEVLNDTWTSYP----SW----SSEEVgtTAI--KKSNLEEFHCKTEDERY 68  
CAP31658      923 cTLGPSYRLMKDS-KEAACSGRVELEpdiKETLNDKWTSYP----SW----SSEDTgnQAI--KKSNLEEFHFRTEDERY 991  Caenorhabditi...
ESN99563      814 ELDMVMNLNMSVLLGLESLARRMR-SMTSD 842  Helobdella robusta
ESN92146      624 QLDIILENMQSTLDVMRFVQWKME-NMTCD 652  Helobdella robusta
1_pfamImport   68 ELDVVLETNLATIRVLESVQKKLS-RMAPE 96  
XP_004987881  827 ELDMLLATNQSTINALQTCYRECRsKTNag 856  Salpingoeca rosetta
XP_001743653  996 ELDLILECNLATIRVLEMVMHELQ--LRPE 1023 Monosiga brevicollis MX1
XP_003114860  934 ELDIVVDSNRTIMEELSKTLRNFQ-TMSEE 962  Caenorhabditis remanei
EGT52598      926 EFDIIIDSNKAVLEDLAKVLRDYE-ALSDE 954  Caenorhabditis brenneri
A5JYW9        868 ELDIIVDSNRTVIEQLSKTLRDYE-AMSDE 896  Caenorhabditis elegans
8_pfamImport   69 EMDIIIDSNRTIIEQLSKTLRDIE-SMSDE 97  
CAP31658      992 ELDIIVDSNRTIMEELEKTLTDIE-AMSDA 1020 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap