6CFZ


Conserved Protein Domain Family
DASH_Spc19

?
pfam08287: DASH_Spc19 
Click on image for an interactive view with Cn3D
Spc19
Spc19 is a component of the DASH complex. The DASH complex associates with the spindle pole body and is important for spindle and kinetochore integrity during cell division.
Statistics
?
PSSM-Id: 400540
View PSSM: pfam08287
Aligned: 82 rows
Threshold Bit Score: 82.2914
Threshold Setting Gi: 511000978
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CFZ_I         4 ADCVCSLRTSLAFLESSVATLDNGVQ---DFPRLC-HVLRTVRHYELIPQTTLAAAEASLRDEIGPFIQLLLDRAEKHLD 79  Chaetomium ther...
CAR26922       6 ERSVGYLEASNELLRRTVTKLQDNAE---SNNFLAqTMLDCKRVFELVPEYDVHKAKLDLIEEVEPLVRTLEEKLDKSTV 82  Zygosaccharomyc...
Q6FU86         5 EQCVNSLEAIVHQLDGSVSRLARNGE---ASNELCeGILKIKRVFELVPEYDVESARLALFEEVDPMVKTLGDKIEKALI 81  [Candida] glabr...
XP_001644433   6 EQSVDSLSSAIVMMQRSIEKLKREGE---ANNSLTgSVLQSKRVFELISGYDVDRAKLAKSEEVDPLVRTLNDKLDKSLG 82  Vanderwaltozyma...
XP_003682555   6 ERSADSLESTVGLLKGSVETLKKNSR---PNTYLTqTMLKSRRVFELVLEYDVQRAKLDLIEEVEPLVSILQDKLGKSLN 82  Torulaspora del...
CCD24133       6 EESVKSFERMIGLLQTTVDTLKHDSE---DNTHLTeTLLMSRRVFELVPEYDVQRAKLSLIEEVDPIVKTLEDKLQKSTG 82  Naumovozyma dai...
CCC68381       6 DESVECFQDMISQLQGSVDTLKSNSE---ENNYLTeTMLQSRRVFELVPEYDVQRAKLSLIEEVDPVVKTLEEKLRKSLS 82  Naumovozyma cas...
CCF56920       6 ESSVVSLESTISLLQDSIETLKTDSK---DNNYLTdTMLRCNQVFELIPEFDIERARNDLNEEVEPLIRTLQEKLKKSLS 82  Kazachstania af...
Q750P7         6 DESCVALESSVKLLGKTLERLAEQGE---HSRRLTsTLLRSKRVFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLN 82  Eremothecium go...
XP_004181887   6 TTCVSLLKSIVNNASSTNEILRSDPNnsaDY-------LKTHRVFELITEYDVEQARIGQIQQQSELLQKLYTKIGGKLN 78  Tetrapisispora ...
6CFZ_I        80 RQARRIETLKARAELNAGRLSQy------SGDGHNNGKFSGQGMDFRKsrp------lnGEAALRAKVVRQRKEALKYSV 147 Chaetomium ther...
CAR26922      83 RMTRELDTLQQTYELNKLRLSKsk----dVETGNEMDV--------STdavim--tsstNEELAQLKDLKSRKMELQSRL 148 Zygosaccharomyc...
Q6FU86        82 RKRRELENLRQTSELNSLRLSGdlyfsetGIDNQDMDV--------STdaiai--asatDAELDELRALKARRAELQELL 151 [Candida] glabr...
XP_001644433  83 KLQRELDTLQQTYELNKLRLNNn------SAGSMDVDV--------STdmvim--asstNEELEELKELKLTREALQRQL 146 Vanderwaltozyma...
XP_003682555  83 KMRRELDTLQQTYELNKLRLNKk--------SYTDFDV--------STdvvim--gsttNEELEELKKLKQQKEMLQKKL 144 Torulaspora del...
CCD24133      83 KLQRELDTIQQTCELNKLRLNNnhrtnltTGTSNEMDAg-------NLstdvvvmgsstNEELDTLRALKNRKQELEERL 155 Naumovozyma dai...
CCC68381      83 KMQRELETLQQSCELNELRLNNth----tTGQEGDVDM--------SSdnlvv-masstNEELETLKQLKTTKRELELKL 149 Naumovozyma cas...
CCF56920      83 KMTRELDTLKQTFELNQLRLNNtatnnetDLSSDDINV--------STddvvm--asstNEELEELKRLRLKREELQERL 152 Kazachstania af...
Q750P7        83 KLERERATLQQTYELNQLRLNNrl----aGSGGR------------RPvvmg----tstTEELGRLREAKQRKAALEREI 142 Eremothecium go...
XP_004181887  79 LLSGELPKLQQQRALLQARLERnnssirdEESLENAEELVTMSNATe-------------eEVSKLQSLKAKRLELQKQL 145 Tetrapisispora ...
6CFZ_I       148 ERL 150 Chaetomium thermophilum
CAR26922     149 QMl 151 Zygosaccharomyces rouxii
Q6FU86       152 Dgr 154 [Candida] glabrata CBS 138
XP_001644433 147 QEL 149 Vanderwaltozyma polyspora DSM 70294
XP_003682555 145 Ell 147 Torulaspora delbrueckii
CCD24133     156 AQl 158 Naumovozyma dairenensis CBS 421
CCC68381     150 AHl 152 Naumovozyma castellii CBS 4309
CCF56920     153 NQL 155 Kazachstania africana CBS 2517
Q750P7       143 AEv 145 Eremothecium gossypii ATCC 10895
XP_004181887 146 Dsi 148 Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap