1U22,3BQ5,3T0C


Conserved Protein Domain Family
Meth_synt_1

?
pfam08267: Meth_synt_1 
Click on image for an interactive view with Cn3D
Cobalamin-independent synthase, N-terminal domain
The N-terminal domain and C-terminal domains of cobalamin-independent synthases together define a catalytic cleft in the enzyme. The N-terminal domain is thought to bind the substrate, in particular, the negatively charged polyglutamate chain. The N-terminal domain is also thought to stabilize a loop from the C-terminal domain.
Statistics
?
PSSM-Id: 400526
View PSSM: pfam08267
Aligned: 49 rows
Threshold Bit Score: 392.713
Threshold Setting Gi: 81437908
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U22_A   3 SHIVGYPRXGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQXSaaGTKF----IPSNTFAHYDQVLDTTAXLGAV 78  thale cress
Q0WNZ5  51 SHIVGYPRIGPKRELKFALESFWDGKTNVDDLQNVAANLRKSIWKHMAhaGIKY----IPSNTFSYYDQMLDTTAMLGAV 126 thale cress
Q93J59  12 ATVYGYPRQGPNRELKKAIEGYWKGRVSAPELRSLAADLRAANWRRLAdaGIDE----VPAGDFSYYDHVLDTTVMVGAI 87  Streptomyces coelicol...
Q83GT4   4 GTILGYPRLGPRRELRDYLYSYWQGKISEEVLEEKTRLLREETHRRLIllGLSAenysIP-ESFSYYDHVLDAAVHVGAV 82  Tropheryma whipplei s...
Q8NRB3   7 STVAGLPRIGAKRELKFALEGYWNGSIEGRELAQTARQLVNTASDSLS--GLDS----VPFAGRSYYDAMLDTAAILGVL 80  Corynebacterium gluta...
Q8FQB2   7 STIAGVPRIGAHRELKFALEGFWSGTVSGRELGQTATTLTNDYCDQLAaaGLDS----IPTAGRSYYDAMLDTTALLGVF 82  Corynebacterium effic...
Q73WJ9   8 ATVVGSPRIGPKRELKRATEGYWAGRTGRAELEKVAATLRRDTWAGLAaaGLDS----VPVNTFSYYDQMLDTAVMLDAL 83  Mycobacterium avium s...
O05564  12 ATVTGSPRIGPRRELKRATEGYWAKRTSRSELESVASTLRRDMWSDLAaaGLDS----VPVNTFSYYDQMLDTAFMLGAL 87  Mycobacterium leprae TN
O67606   4 TYAFGFPKLGEKREFKRLLENYWKGKISQEELIKGMEELNLWRANLYRe-NVEI----IPSNELSYYDFMLDTTVMVGAI 78  Aquifex aeolicus VF5
3BQ5_A  35 AYAFGFPKIGEKREFKKALEDFWKGKITEEQFEEEMNKLRMYMVENYRk-NVDV----IPSNELSYYDFVLDTAVMVGAV 109 Thermotoga maritima
1U22_A  79 PPRYGytg------geIGLDVYFSXARGNASVPAXEXTKWFDTNYHYIVPELGPEVNFSYASHKAVNEYKEAKALGVDTV 152 thale cress
Q0WNZ5 127 PSRYGwes------geIGFDVYFSMARGNASAHAMEMTKWFDTNYHYIVPELGPDVNFSYASHKAVVEFKEAKALGIDTV 200 thale cress
Q93J59  88 PERHRaav------aaDALDGYFAMARGTQEVAPLEMTKWFDTNYHYLVPELGPDTVFTADSTKQVTELAEAVALGLTAR 161 Streptomyces coelicol...
Q83GT4  83 PSRFSwlln----dgiVDLNAYFTLARGDRSLAPLESLRYFGSSYHYLVPEIDGNTHFALTSHRVITQFEQAKQAGVNVR 158 Tropheryma whipplei s...
Q8NRB3  81 PERFDdiadhendglpLWIDRYFGAARGTETLPAQAMTKWFDTNYHYLVPELSADTRFVLDASALIEDLRCQQVRGVNAR 160 Corynebacterium gluta...
Q8FQB2  83 PERFQnlddhpndglpAHIDRYFATARGTAELPASAMTKWFDTNYHYLVPELSADTRFILDDTALLTDIHDQLTRGHDVR 162 Corynebacterium effic...
Q73WJ9  84 PERarq--------vsDDLDRYFAAARGNSDVAPLEMTKWFDTNYHYIVPEIAPTTKFALNPDKVLSELKEALAQGIPAR 155 Mycobacterium avium s...
O05564  88 PARvaq--------vsDDLDQYFALARGNNDIKPLEMTKWFDTNYHYLVPEIEPATTFSLNPGKILGELKEALEQRIPSR 159 Mycobacterium leprae TN
O67606  79 PSRFGe---------yRGLDTYFEMARGK---NALELTKWFNTNYHYLVPELE-GENFKLLINRPLEDYKFFKEKGINTV 145 Aquifex aeolicus VF5
3BQ5_A 110 PERFGe---------yRGLSTYFDMARGG---KALEMTKFFNTNYHYLVPEIETE-EFYLLENKPLEDYLFFKSKGIETA 176 Thermotoga maritima
1U22_A 153 PVLVGPVSYLLLSKAAKGVdksfELLs-----------------LLPKILPIYKEVITELKAAGATWIQLDEPVLVXDL- 214 thale cress
Q0WNZ5 201 PVLIGPMTYLLLSKPAKGVeksfCLLs-----------------LIDKILPVYKEVLADLKSAGARWIQFDEPILVMDL- 262 thale cress
Q93J59 162 PVLVGPVTYLLLAKPAPGApadfEPLt-----------------LLDRLLPVYAEVLTDLRAAGAEWVQLDEPAFVQDR- 223 Streptomyces coelicol...
Q83GT4 159 PTILGPVSLLMMSRSHGPNa--iNPIe-----------------RLQDLVPVYSELFEKLYNSGCKFVQVDEPAVTHNTf 219 Tropheryma whipplei s...
Q8NRB3 161 PVLVGPLTFLSLARTTDGS----NPLd-----------------HLPALFEVYERLIKSFDTE---WVQIDEPALVTDV- 215 Corynebacterium gluta...
Q8FQB2 163 PVLIGPLTYLSLSRTTDGS----DPLd-----------------HLETLFEVFERLLAKLPTP---WVQLDEPSLVTDV- 217 Corynebacterium effic...
Q73WJ9 156 PVVIGPITFLLLSKGVDGAg---APIe-----------------RLEELVPIYAELLSLLADNGAQWVQLDEPALVTDM- 214 Mycobacterium avium s...
O05564 160 PVIIGPVTFLLLSKGINGGg---APIq-----------------RLEELVGIYCTLLSLLAENGARWVQFDEPALVTDL- 218 Mycobacterium leprae TN
O67606 146 PHVIGLFTFLKLSKAPKRV----EEEglpviilekldtkerlekFTKALLPVYKELLESLKNEGVNRVHFEEPALVTDL- 220 Aquifex aeolicus VF5
3BQ5_A 177 PWVIGPFTFLYLSKRNGEW----IRRpnq------------mekLLESLVSVYKEVFEKLVENGCKEILVNEPAFVCDL- 239 Thermotoga maritima
1U22_A 215 -EGQKLQAFTGAYAELESTLSGLNVLVETYFADiPAEAYKTLTSLK-GVtAFGFDLVR-GTKTLDLVKA-GFp--EGKYL 288 thale cress
Q0WNZ5 263 -DTSQLQAFSDAYSHMESSLAGLNVLIATYFADvPAEAYKTLMSLKcVT-GFGFDLVR-GLETLDLIKM-NFp--RGKLL 336 thale cress
Q93J59 224 -TPAELNALERAYRELGALTDRPKLLVASYFDR-LGDALPVLAKAP-IE-GLALDFTDaAATNLDALAAvGGl--PGKRL 297 Streptomyces coelicol...
Q83GT4 220 gIQKSQELLVDAYKFLSSRKLRPEILVAMSYGN-AADQVDALATTG-VE-AMAFNLI-------DGAVPfANpslADKAL 289 Tropheryma whipplei s...
Q8NRB3 216 -APEVLEQVRAGYTTLA---KRDGVFVNTYFGS-GDQALNTLAGIG-LG-AIGVDLVThGVTELAAWK-------GEELL 281 Corynebacterium gluta...
Q8FQB2 218 -APEVLERVRAGYARLA---TRGGVFVNTYFGA-GDQALDTLAGLG-LG-AIGVDLVSdGVTALEAWK-------GEELL 283 Corynebacterium effic...
Q73WJ9 215 -CADAPALAEAVYNKLGSASNRPAIYVATYFGD-PGASLAGLARTP-VE-AIGVDLVYgPDTAVAAVPEl-----AGKTV 285 Mycobacterium avium s...
O05564 219 -SPDAPALAEAVYTALGSVSKRPAIYVATYFGN-PGASLAGLARTP-IE-AIGVDFVCgADTSVAAVPEl-----AGKTL 289 Mycobacterium leprae TN
O67606 221 -EDYDWEILNEIYSEL--SKVGVDLGILTYYDS-VSDYDKFV-NLP-VK-ALHFDLVS-NEENLKNIKEkGFp--EDKEL 290 Aquifex aeolicus VF5
3BQ5_A 240 -EKAHWDLILNVYRELS----EFPLTVFTYYDS-VSDYEACV-SLP-VK-RLHFDFVS-NEENLKNLEKhGFp--EDKKL 307 Thermotoga maritima
1U22_A 289 FAGVVDGRNIWANDFAASLSTLQALEGIV 317 thale cress
Q0WNZ5 337 FAGVVDGRNIWANDLSASLKTLQTLEDIv 365 thale cress
Q93J59 298 VAGVVNGRNIWINDLQKSLSTLGTLLGLA 326 Streptomyces coelicolor A3(2)
Q83GT4 290 FGGVIDGRNIWRGDLAAAYYKLERLRELS 318 Tropheryma whipplei str. Twist
Q8NRB3 282 VAGIVDGRNIWRTDLCAALASLKRLAARG 310 Corynebacterium glutamicum ATCC 13032
Q8FQB2 284 VAGIVDGRNVWRTDLCAALGTLRRLQARG 312 Corynebacterium efficiens YS-314
Q73WJ9 286 VAGVVDGRNVWRTDLAAALDKLTTLLGSA 314 Mycobacterium avium subsp. paratuberculosis K-10
O05564 290 VAGIVDGRNIWRTDLESALSKLATLLGSA 318 Mycobacterium leprae TN
O67606 291 IAGIINGRQPWRANLREKVKLLEELLKVS 319 Aquifex aeolicus VF5
3BQ5_A 308 VAGVINGRQPWKVDLRKVASLVEKLGASA 336 Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap