4ZPL,1WYJ,1WUZ,6MER,4ZI8


Conserved Protein Domain Family
Cadherin_2

?
pfam08266: Cadherin_2 
Click on image for an interactive view with Cn3D
Cadherin-like
This cadherin domain is usually the most N-terminal copy of the domain.
Statistics
?
PSSM-Id: 400525
View PSSM: pfam08266
Aligned: 45 rows
Threshold Bit Score: 121.48
Threshold Setting Gi: 159163460
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ZPL_A         2 TIRYSVAEEMESGSFVANVAKDLGLEVGKLAERGARLVAEGNRLHFRLHRKTGDLFVKEKLDREALCGKSDPCVLHFEII 81   house mouse
NP_001009588  28 QISYNVLEEVKPGTTVGNLAKDINLSVKELQSRGFRIVSGSKKQYFSVNVDTGALQVSERIDREELCAGAVACSVNLEAV 107  zebrafish
NP_001009595  25 QIVYSISEEADPGTTVGPIAKDLNLNLHELQLRGFQLVSGPNKRYFDVNLKSGVLLVKERIDRELLCGRSSRCSLEIEAI 104  zebrafish
NP_001009596  28 hIVYTVSEETNPGTTVGNLAKDLNLNLQDITNRGFQLVSGANKRYFELNSKTGFLHINDRIDRDELCGRSLKCSFPLEAI 107  zebrafish
NP_001009590  28 QFVYTVSEEANPGTTVGNLVKDFNLNIQDLEARGFHIVRGPNERYFDVNKKTGILHVKERIDREEICEQNIKCSLPLEAM 107  zebrafish
1WUZ_A         4 QIHYSIPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVI 83   house mouse
EDL76394      32 PVRYSIPEELDRGSVVGNLAKDLGLSVLEVSARKLRVSA--EKMHFSVDSESGDLLVKDRIDREQICKGRRRCELQLEAV 109  Norway rat
NP_001032236  32 QVRYSIPEEMAMGSVVGNLAEDLGLPVQDLLIRNLRVIS--EKPYLTVNPENGNIVVSDKIDRELLCFQSPLCVLPLEIV 109  Norway rat
6MER_A         2 PIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIA--EKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMV 79   human
EDL76382      32 QIRYKIPEEMPTGSVVGNLAKDLGFGVQELPTRKLRISS--EKPYFTVSSESGELLVSSRLDREQICGKKLVCSLEFEAV 109  Norway rat
4ZPL_A        82 LA 83   house mouse
NP_001009588 108 VN 109  zebrafish
NP_001009595 105 VN 106  zebrafish
NP_001009596 108 VN 109  zebrafish
NP_001009590 108 IS 109  zebrafish
1WUZ_A        84 VD 85   house mouse
EDL76394     110 LE 111  Norway rat
NP_001032236 110 AE 111  Norway rat
6MER_A        80 AE 81   human
EDL76382     110 AE 111  Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap