Conserved Protein Domain Family
PaaX_C

?
pfam08223: PaaX_C 
PaaX-like protein C-terminal domain
This family contains proteins that are similar to the product of the paaX gene of Escherichia coli. This protein is involved in the regulation of expression of a group of proteins known to participate in the metabolism of phenylacetic acid.
Statistics
?
PSSM-Id: 369764
View PSSM: pfam08223
Aligned: 27 rows
Threshold Bit Score: 69.2434
Threshold Setting Gi: 122480084
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011776619   173 MRPKISEWWDLKELDDQFTEFLELYDGaeqqwaervgdDPevAVAEsteelrrDAFRYYIPMLTMWRKFPYRDPNLPADY 252 Micrococcaceae
Q4J800         163 PLEIVRKCWDLKEVEEKYKEFVNQWGKvmen--------issLKPN-------EAFITRIRLVHEYRKFLHIDPNLPKDL 227 Sulfolobus ac...
Q97YK8         167 PNHLVERCWNLVEVEQAYKSFLEEWSPmlkk--------vnsMKSN-------EAFVTRIELVHEYRKFLNIDPDLPEDL 231 Saccharolobus...
Q63YY1         166 QEARIRALWDGDALSDTYRTLGAQLEDwlar----apeLDldVAAR-------EAFLLGGKAI---RQVVF-DPLLPEPF 230 Burkholderia ...
Q221M7         165 REAVVHQLWNGQALTRTYRQLRAELEAwlar----anqLPldAAAR-------ESFLLGGKAIH---QLVF-DPLLPEPF 229 Rhodoferax fe...
Q5Z0E5         182 PREKVTTWWDLDELTALYTEFLQQYRPvlyr----vtsET--VTAR-------EAFQLYVPMLTQWRRLPYRDPGIPLSL 248 Nocardia farc...
Q0SFS4         185 MGDAATRWWDLDGIAARHRDFLDRHRVals------aaEE--VSPR-------EAFVRFVPLLDEWRIIPYIDPGLPAGM 249 Rhodococcus j...
Q82KR4         172 TFEAVARWWDLAAIAKQHEEFLDRHARvlhd---wearED--TEPE-------EAYRDYLLALDSWRHLPYADPGLPAAL 239 Streptomyces ...
jgi:Noca_1206  161 TGA-----WDLAALRLAYEGWLQAADDlveq---hlaaHE--DPDE-------AAFAARFHLVHEWRKFLFTDPGLPDAL 223 Nocardioides ...
jgi:Strop_0708 162 AMGVVRRAWDLAEIGQAYEQFVAEQRAllag---vtvrSP----DE-------EAYAARFRLVHAWRTFLFRDPQLPPAL 227 Salinispora t...
WP_011776619   253 LPPEWHGPAVRRTFQAVHRLAAPLAAAHAHE 283 Micrococcaceae
Q4J800         228 LPPNWVGYEAYELFQKLRNKLSTLSDQFFKS 258 Sulfolobus acidocaldarius
Q97YK8         232 LPQNWIGYKAYDLFMKLREELTPKANEFFYK 262 Saccharolobus solfataricus
Q63YY1         231 V-----DVAARAAFIECARRYVGAGHRIWRA 256 Burkholderia pseudomallei
Q221M7         230 V-----DTRERHAFIQAVHHFDEAGRAIWNR 255 Rhodoferax ferrireducens T118
Q5Z0E5         249 LPPAWQGEAAGTLFDQLNEVLNPLAHKHALA 279 Nocardia farcinica
Q0SFS4         250 LPEDWPGADSVRLFASARDRYLDGSRDWVRS 280 Rhodococcus jostii RHA1
Q82KR4         240 LPEDWPGARSAAVFRALHERLRDAGAAFAAG 270 Streptomyces avermitilis
jgi:Noca_1206  224 LPRDWPGHAAAELFAGAAGRLKPGADRFVAR 254 Nocardioides sp. JS614
jgi:Strop_0708 228 LPERWPGTAAGSFFDRHAARLRPAADRYVEA 258 Salinispora tropica CNB-440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap