5EY2


Conserved Protein Domain Family
HTH_CodY

?
pfam08222: HTH_CodY 
Click on image for an interactive view with Cn3D
CodY helix-turn-helix domain
This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk.
Statistics
?
PSSM-Id: 369763
View PSSM: pfam08222
Aligned: 4 rows
Threshold Bit Score: 108.147
Threshold Setting Gi: 1064245361
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5EY2_A       214 TEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGXKGTYIKVLNDKFLQELAklK 274
Q834K5       202 EEGRLTASSIADEIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKVLNQQFIKELE--K 260 Enterococcus faecalis
WP_000421292 197 TEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTYIKVLNDKFLHELAklK 257 Bacillus
P63847       201 LEGRLTASVIADRIGITRSVIVNALRKLESAGIIESRSLGMKGTYLKVINEGIFDKLKeyN 261 Streptococcus agalactiae 2603V/R
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap