6F44


Conserved Protein Domain Family
HTH_9

?
pfam08221: HTH_9 
Click on image for an interactive view with Cn3D
RNA polymerase III subunit RPC82 helix-turn-helix domain
This family consists of several DNA-directed RNA polymerase III polypeptides which are related to the Saccharomyces cerevisiae RPC82 protein. RNA polymerase C (III) promotes the transcription of tRNA and 5S RNA genes. In Saccharomyces cerevisiae, the enzyme is composed of 15 subunits, ranging from 160 to about 10 kDa. This region is a probably DNA-binding helix-turn-helix.
Statistics
?
PSSM-Id: 400500
View PSSM: pfam08221
Aligned: 17 rows
Threshold Bit Score: 66.1
Threshold Setting Gi: 74621431
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6F44_O  47 FLYKELVKAHLGERAASVIGMLVALGRLSVRELVEKIDg-MDVDSVKTTLVSLTQLRCVKYLQE 109 Saccharomyces cerevisiae S288C
Q6BQ18  17 NLYTTLAKTHLGEVAAIIVSTLISYGRLTAKDLSNKSE--VPLKLVKSTLVSLIQLSCISYWKE 78  Debaryomyces hansenii CBS767
Q6FSJ4  66 FLYTEVIKSYLGERASTVISLLISLGRLTVREIYEKLNftMSIDSIRRTLVSLTQLRCVRYLEE 129 [Candida] glabrata CBS 138
Q6CWJ7  51 FLYSELARSHLGERASTVLSVLVNKGRLSTREIHSFIPe-LSLSSIKTVLVSLIQLRCVQYLEE 113 Kluyveromyces lactis NRRL Y-1140
Q758N7  35 FLYTEVARSHLGERAGRVIELLLNKGRLSVSELVHLAPe-LGSKSVRTVLVSLIQLRCVQYLEE 97  Eremothecium gossypii ATCC 10895
Q8STX1   3 GLVTEILAD-YGTIPQKISLFLKKRNGSTVDQMLQNTS--LTRIQVVHGLSLMIQRRLVKYFQY 63  Encephalitozoon cuniculi
Q9VG60   7 HLSSAILEQCFGKVVQAVADCLFSATTRTLGQITSATK--LSRKEVAFALAVLVKFRLVDFAAS 68  fruit fly
Q8IG67   9 QMCVIIIEDIFGKIVAKVMETILKESCQLSTLFYKLKGq-ISNTLIRKSVSTLINFGFVTFHLD 71  Caenorhabditis elegans
Q8WZW7   9 ECCTLLVDELYGQLPARVYATLFQRGKLSVRLISQFSK--LSARQVKNGLCVLQQHNLLFYSVD 70  Neurospora crassa OR74A
Q9C106   7 ELCEILVEEFFGDCCSAVASALLRHGRLTIPMLQKRTS--LPGPKIRQALVSLMQHHMVLYVTV 68  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap