5AJ3


Conserved Protein Domain Family
DUF1713

?
pfam08213: DUF1713 
Mitochondrial domain of unknown function (DUF1713)
This domain is found at the C terminal end of mitochondrial proteins of unknown function.
Statistics
?
PSSM-Id: 400496
View PSSM: pfam08213
Aligned: 41 rows
Threshold Bit Score: 30.3268
Threshold Setting Gi: 765553328
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AJ3_NN       127 CKNILKIRRRKMNHHKYRKLVKRTRFLRRKVRE 159
XP_003228739  133 CKKILKIRRRKMNKHKYRKLMKRTKFLRKKIKe 165 green anole
ELV12793       65 CKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVRE 97  Chinese tree shrew
XP_015192732  135 CKNVLEIRRRKMNRHKYKKLLKRTKFLRRRVie 167 spotted gar
XP_005057619  123 CRNVLKIRRRKMNRHKYRKLLKRRKFIRRRIKe 155 Collared flycatcher
XP_011260356  124 AVRLIVIRHKKMKKHKRKKLRKRMHFLWLKIRN 156 Florida carpenter ant
EFX87535      107 AARMIVIRRRKMKKHKLKKLRKVRKFEYRRMal 139 common water flea
BAK37822       11 VGSVIKKRRKRMAKKKHRKLLKRTRIQRRRAGK 43  Microlunatus phosphovorus NM-1
jgi:Srot_1640   1 MGSVIKKRRKRMSKKKYRKRLKATRVQRRKLGK 33  Segniliparus rotundus DSM 44985
XP_002113861  133 CGSVMKKRRKKIKLHKLKKKRRRDRFKVKRt-- 163 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap