4EG2


Conserved Protein Domain Family
dCMP_cyt_deam_2

?
pfam08211: dCMP_cyt_deam_2 
Click on image for an interactive view with Cn3D
Cytidine and deoxycytidylate deaminase zinc-binding region
Statistics
?
PSSM-Id: 400494
View PSSM: pfam08211
Aligned: 64 rows
Threshold Bit Score: 102.224
Threshold Setting Gi: 226515479
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4EG2_C           160 L----QEYLPESFGPADLGIDs----------GLXSPVNHGKTSDD-------------DEE-LIQQALRAXNISHSPYT 211 Vibrio chol...
XP_005852191     127 L----GQLLPMRFKPADLLPDpa-------tpLLLQPQDNRVQLTAtarkllkaragdaAFErAAAEALAAAVGSYSPYS 195 Chlorella v...
jgi:MICPUN_53978 184 lvlplcDLLPHSFGPLDLTHDes-------lpLMLEERHNGLRFIPgltpeat----deldaaAAALALAEANAAYAPYS 252 Micromonas ...
XP_009137853     141 LlprhSNLLP----------------------DLLQARDNKLLLVSsegc---------edrlLLRTALAAANRSFAPYS 189 field mustard
Q9XEX4           140 L----STFLPQGL------ISqan------vpRLLERNFNCIELINhslymdicsysehCNH-LNCRALKAATISYAPDS 202 thale cress
EFH45685         139 L----STFLPQKF-----FSVynevp-eyfarLLDHNRRNGLTLIDpnpireicvnsdsCTH-LKCRALNAANRSYAPYS 207 Arabidopsis...
Q9S789           140 L----STYLPQKY-----LSLynevpkyffarLLDENRNNGLTLINpnpird-cldseiCNH-LSCRALKAANRSYAPYS 208 thale cress
Q9SU87           144 L----KLLLPYRFTPDDVLPKgs--------pLLLEKRDNCLTLSGsteeic-----ssdcshLKCKALAAANNSFSPYT 206 thale cress
XP_002869422     137 L----ESHMPDKFGPESILPAep--------sLLLVECDNRLALFNsnl-----------yplLKLVALQAAKKSYAPHS 193 Arabidopsis...
ADO42206         183 gtyvmDDLLPFPFNPAALETAg----------AIPGHVAHDLALADg---------------pARDLLIHAGNRAHVPYS 237 Ketogulonic...
4EG2_C           212 QNFSGVALKXRSGAIYLGAYAENAAFNPSLPPLQVALAQAXX--XGES------FEDIEAAALVESATGKISHLADTQ 281 Vibrio cholerae
XP_005852191     196 RCPSGLAIVTQAGGVYSGGYVESAAYNPSLPPLQTAIVAAVI--DGMP------YTAVDEVVLVELADGQVQHARTTR 265 Chlorella var...
jgi:MICPUN_53978 253 ASPAGLALVDDDGVIHAGRSVESAAYNPTMSPLHAALVAAVGg-AGMGdanggeWGRIESATLVEMSGAPVQYAGtva 329 Micromonas co...
XP_009137853     190 KCPSGVALKDREGQVYRGWYIESAAYNPSLGPVQAALVDFVIs-GGTK------FEDIVEAVLVEKRDAVVSQEKTAK 260 field mustard
Q9XEX4           203 KCPSGVALIDHRGKVYSGGYMESVAHNTSLGPVQAALVDFVAngDGQE------FKNIVEAVLVEKKCGVLSQEATAR 274 thale cress
EFH45685         208 NCSSGVALMDHQGKVYSGWYMESVAYNP----IQAALVDFVTngGGHE------FDKIVQAVLVEKRVAKFSQVARAR 275 Arabidopsis l...
Q9S789           209 KSPSGVALMDFQGRVYSGWSIESVA-NPILGAAQAALVDFMTngGGHE------FNNIVRGFLVEKRDAKLSHLATAR 279 thale cress
Q9SU87           207 ESPSGVALQDDEGKWYRGWYIESVAYSPSLGPVQAALVDFVArsRGKG------FNKIVEAVLVEKNNARVSQERTAK 278 thale cress
XP_002869422     194 KCPSGVALV-CEGKVYRGWYIETVAYNISLGPVQAALVDFMArgEGKG------FDKITRAVLVEKKDAKVRQEDTAR 264 Arabidopsis l...
ADO42206         238 HCPSALVLELGDGTQVWGTSIESCAYNPTIMPAQAALIMLLD--HGHS------YGDIARAWFARPKGAVVDlarasa 307 Ketogulonicig...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap