1UEB,6J7M


Conserved Protein Domain Family
EFP_N

?
pfam08207: EFP_N 
Click on image for an interactive view with Cn3D
Elongation factor P (EF-P) KOW-like domain
Statistics
?
PSSM-Id: 400491
View PSSM: pfam08207
Aligned: 165 rows
Threshold Bit Score: 49.7274
Threshold Setting Gi: 81658859
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UEB_B         3 SVTDLRPGTKVKMDGGLWECVEY-QHQK-LGRGGAKVVAKFKNLETGATVERTFNSGEKL 60  Thermus thermophilus
Q7MM44         3 KASEIKKGFAIESNGKTLLVKDIeVTTPgGRGGSKIYKMRCTDLATGARVEERYKSDDVV 62  Vibrio vulnificus YJ016
Q21GV1         3 KASDIKKNQAIEHNGKVYLIKDVyKSTSqGRAGGSIYRVRMYEVATGLKVDESFKADEMI 62  Saccharophagus degradans 2-40
WP_013051026   3 KASDVKKNTAIEFNNSVYLIRDIeRSVPqGRSGGSLYRMRMYDVASGSKLDQTFKADDMI 62  Shewanella violacea
Q8P9M3         2 KANDIKKGNVVEYNGGIYQIRDIeRSSPqGRGGNVRFRFIMYSVPGGAKLDASFDADDNL 61  Xanthomonas campestris pv. campestr...
A6VX18         3 KASEIKKNIAISYDNKTYIVKDIeRSVPqGRAGGSLYRMRMYDVVTGRKLDETFKDSDMI 62  Marinomonas sp. MWYL1
Q3IEF7         3 KASEVKKGTAIDFNGRVLVVKDIvRSVPqGRAGGSLYRMRLYDVVTGSKVDETFKDSDML 62  Pseudoalteromonas haloplanktis TAC125
WP_014872133   3 rASEIKKNSAIEFEGRVYFVKDIeRSVPqGRAGGSLYRMRLYDVVTNIKKDETFKDGDML 62  Marinobacter
Q485Q8         3 KASDIKKNAAIEHNGKVLIVRDItRSVPqGRAGGSLYRMRLYDVVTGGKVDETFKAEDML 62  Colwellia psychrerythraea 34H
Q15SU8         3 KASEVKKNAAIEHNDKVYVVKDInKLTPsGRAGASLYRMRLYEVTTGAKADESFKADEMI 62  Pseudoalteromonas atlantica T6c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap