Conserved Protein Domain Family
BssC_TutF

?
pfam08201: BssC_TutF 
BssC/TutF protein
BssC short protein (57 amino acids) has been described as the gamma-subunit of benzylsuccinate synthase from Thauera aromatica strain K172. TutF has been identified and described as highly similar to BssC in T.aromatica strain T1.
Statistics
?
PSSM-Id: 369746
View PSSM: pfam08201
Aligned: 9 rows
Threshold Bit Score: 70.5829
Threshold Setting Gi: 218761425
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006524673    1 MATCAECKSFFAIPENADDFKPGKGDCVREEKDQKGKYWLSKPVMGNVAAdnCKYFMK 58  Desulfallas gibsoniae
WP_014955669    1 MSKCESCKFFIRVPNDADDFEPGKGDCITEVKDEKGKYWLSTPVFQDTDA--CPNFNK 56  Desulfobacula toluolica
Q5P6A3          1 MTTCKDCEFFFSVPEDADDFEKSKGDCVTQKEDEKGKYWLTRPVFENDQC--CGTFHK 56  Aromatoleum aromaticum EbN1
Q39VF0          1 MTTCKNCSFYFAVPENAGDFEAGKGDCVIEKEDAKGKYWLSKPTRNDSPS--CKAF-K 55  Geobacter metallireducens GS-15
jgi:Geob_2439   1 MTTCQDCSFYFAVPENAGDYEPGRGDCVTQKEDAKGKYWLSKPTVHATPS--CPTFKK 56  Geobacter daltonii FRC-32
CCK78656        1 MSKCEKCAFFFPIPEEDMDFEPDKGDCVRQQEDTKGKFWLSRPVFKNSDA--CEHlsp 56  Desulfobacula toluolica Tol2
ACL03891        1 MSTCSDCKSFFP----RED-EPGKGDCVRRVVDPRQAYYTTRPKNPEDDAsgCGEFQK 53  Desulfatibacillum aliphaticivorans
WP_012610861    1 MSTCAECRSFFL----RED-EPGQGDCVRRVVDPRQAFYQSKPVREDNDAsgCESFQK 53  Desulfatibacillum
jgi:Desgi_0658  1 MANCAECKSFFPIPESEDDFEQGKGDCIREEKDPKGKFWLSKPVMSDMPAdnCKYFTK 58  Desulfallas gibsoniae DSM 7213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap