1GJJ


Conserved Protein Domain Family
Thymopoietin

?
pfam08198: Thymopoietin 
Thymopoietin protein
Short protein of 49 amino acid isolated from bovine spleen cells. Thymopoietins (TMPOs) are a group of ubiquitously expressed nuclear proteins. They are suggested to play an important role in nuclear envelope organisation and cell cycle control.
Statistics
?
PSSM-Id: 400486
View PSSM: pfam08198
Aligned: 16 rows
Threshold Bit Score: 77.4
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GJJ_A         2 PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARN 49 
XP_004082931   2 PEFVEDPSLLTKERLRSELLAHSVELPSGTATKDVYVQLYLENLTPRN 49  Japanese medaka
Q5RGX2         2 SEFLEDPSVLTKDKLKSALLANNVALPNGDQRKDVYVQLYLKNLTVQN 49  zebrafish
NP_001018434   2 AQFHEDPALLTKEKLKSELMANNVALPSADSKKDVYVQLYLKNLTVLN 49  zebrafish
CAG08681       2 AEFLEDPSVLTKDKLKNELVANNVPLPSGEHKKEVYVQLYLKNLTVQN 49  spotted green pufferfish
Q6DHI6         2 PVFVEDPAQFSKERLKSELIAHNVALPPPESKKHAYVELYLKHVKTNS 49  zebrafish
2_pfamImport   1 --FSENPAHFSKSRLKSDLVAHNVALPPAKSRKHVYVELHLKHIQRKN 46 
XP_011475751   1 MPFVEDPAHLSIARLKSDLLAHNVALPPAASKKEVYVELHLKNIDQKN 48  Japanese medaka
XP_007250027   2 PVFIEDPTEFSKEQLRAALISHNVELPPGESRKEVYVDLYLKHVRNKN 49  Mexican tetra
XP_015198299   2 PVFVDDPVLLSKERLKSELVAHSVPLPPGEKKKQVYLELYLKHVAHkk 49  spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap