Conserved Protein Domain Family
DegQ

?
pfam08181: DegQ 
DegQ (SacQ) family
This family consists of the DegQ (formerly sacQ) regulatory peptides. The DegQ family of peptides control the rates of synthesis of a class of both secreted and intracellular degradative enzymes in Bacillus subtilis. DegQ is 46 amino acids long and activates the synthesis of degradative enzymes. The expression of this peptide was shown to be subjected both to catabolite repression and DegS-DegU-mediated control. Thus allowing an increase in the rate of synthesis of degQ under conditions of nitrogen starvation.
Statistics
?
PSSM-Id: 285404
Aligned: 3 rows
Threshold Bit Score: 55.4043
Created: 14-Feb-2025
Updated: 28-Apr-2025
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P69889        1 MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTY-LKTS 46  Bacillus licheniformis DSM 13 = ATCC 14580
1_pfamImport  1 MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEY-VKIS 46 
Q99039        1 MEK-KLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYaMKIS 46  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap