Conserved Protein Domain Family
cIII

?
pfam08134: cIII 
cIII protein family
This family consists of the cIII family of regulatory proteins. The lambda CIII protein has 54 amino acids and it forms an amphipathic helix within its amino acid sequence. Lambda cIII stabilizes the lambda cII protein and the host sigma factor 32, responsible for transcribing genes of the heat shock regulon.
Statistics
?
PSSM-Id: 400447
View PSSM: pfam08134
Aligned: 8 rows
Threshold Bit Score: 43.9429
Threshold Setting Gi: 383395223
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ASJ79510      2 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 38  Escherichia phage ECP1
AFH20663     19 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 55  Escherichia phage HK446
Q77W93        2 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 38  Escherichia virus HK97
AFM76254      2 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 38  Enterobacteria phage mEp235
AUM59818      2 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 38  Escherichia virus HK022
AFH20729      2 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 38  Enterobacteria phage HK106
YP_007111473 19 MHFQLAGSGVMSAFYPHESELSRRVKQLIRAAKKQLE 55  Escherichia phage mEpX2
WP_002462809  2 MHLQLAGSGVMSAYYPPESELHRKIRQLIRAAMLRLK 38  Atlantibacter hermannii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap