Conserved Protein Domain Family
AdoMetDC_leader

?
pfam08132: AdoMetDC_leader 
S-adenosyl-l-methionine decarboxylase leader peptide
This family consists of the S-adenosyl-l-methionine decarboxylase (AdoMetDC) leader peptides. AdoMetDC is a key regulatory enzymes in the biosynthesis of polyamines. All expressed plant AdoMetDC mRNA 5' leader sequences contain a highly conserved pair of overlapping upstream ORFs (uORFs) that overlap by one base. Sequences of the small uORFs are highly conserved between monocot, dicot and gymnosperm AdoMetDC mRNA species, suggesting a translational regulatory mechanism.
Statistics
?
PSSM-Id: 369703
View PSSM: pfam08132
Aligned: 3 rows
Threshold Bit Score: 80.5161
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006845441  1 MESKGGLKKKSSSNS-RFYEAPLGYSIEDVRPHGGIEKFRTAAYSNCVRKPS 51  Amborella trichopoda
2_pfamImport  1 MESKGGKKKCSSSSS-LQHEAPLGYTVEDIRPNGGIKKFQSAAYSNCVRKPS 51 
RRT62913      1 MEFKAGKKQSSSSSSsLQYEIPLGYTVEDVRPHGGIRKFQSAAYSNCVRKPS 52  Ensete ventricosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap