Conserved Protein Domain Family
Antimicrobial14

?
pfam08109: Antimicrobial14 
Lactocin 705 family
This family consists of lactocin 705 which is a bacteriocin produced by Lactobacillus casei CRL 705. Lactocin 705 is a class IIb bacteriocin, whose activity depends upon the complementation of two peptides (705-alpha and 705-beta) of 33 amino acid residues each. Lactocin 705 is active against several Gram-positive bacteria, including food-borne pathogens and is a good candidate to be used for biopreservation of fermented meats.
Statistics
?
PSSM-Id: 71544
View PSSM: pfam08109
Aligned: 2 rows
Threshold Bit Score: 54.2402
Threshold Setting Gi: 2493157
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9RMH7 22 GMSGYIQGIPDFLKGYLHGISAANKHKKGRL 52  Lactobacillus casei
P80959  1 GMSGYIQGIPDFLKGYLHGISAANKHKKGRL 31  Lactobacillus paracasei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap