5LUT


Conserved Protein Domain Family
BDHCT

?
pfam08072: BDHCT 
Click on image for an interactive view with Cn3D
BDHCT (NUC031) domain
This is a C-terminal domain in Bloom's syndrome DEAD helicase subfamily.
Statistics
?
PSSM-Id: 400424
View PSSM: pfam08072
Aligned: 15 rows
Threshold Bit Score: 68.4453
Threshold Setting Gi: 1150667309
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LUT_I         24 LYSVXEDICKLVDAIPLHELTSISCAKELLQQRELRRKLL 63   chicken
XP_008102990  379 LYSVMEDICKLVDSIPERDLRFLSCGSELIRHRDYRRQLL 418  green anole
XP_015199130  398 LFSIMEEICQLVDSIPEHELTALSCGRDLLFQRARRRRFF 437  spotted gar
XP_017207538  379 LFSVMESICCLVDTIPEHELIALTCGTELLLQRAHRKRIL 418  zebrafish
XP_015253700  371 LFSIMESICALVDSIPEHELIALSCGDELLLKRAQRKRIL 410  sheepshead minnow
ELK18290      369 LIRVMDNICNLVDTIPDNELKSLDCGNNLLQQRNIRRKLL 408  black flying fox
XP_007479356  373 LFHVMEDICSLVDTIPIIQLKGLDCGNKLLQHRDLRRKLL 412  gray short-tailed opossum
XP_007666291  397 LLRVMEEMCEMVDAIPICELQALRCGNELLRKREHRKRLL 436  platypus
RLV92635      112 LYRVMEAICELVDAIPLQELQALRCARALLQHRELRRKLL 151  Gouldian finch
XP_005999763  421 LYRVMEEICRLVDTIPLDELKALSCGSQLLQQRQHRraii 460  coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap