6OKK,5XYI,5JBH


Conserved Protein Domain Family
RS4NT

?
pfam08071: RS4NT 
Click on image for an interactive view with Cn3D
RS4NT (NUC023) domain
This is the N-terminal domain of Ribosomal S4 / S4e proteins. This domain is associated with S4 and KOW domains.
Statistics
?
PSSM-Id: 400423
View PSSM: pfam08071
Aligned: 47 rows
Threshold Bit Score: 42.9094
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OKK_F             3 KGIKKHLKRVNAPSHWMLNKMGGQYAPKTSSGPHKLL 39  Plasmodium falciparum 3D7
A2BMD1             4 MGGRRHLKTLAAPKFWPVRQRAGIFTVKPSPGPHPIE 40  Hyperthermus butylicus DSM 5456
B1L778             4 MGGSRHLKSLAAPGYYPIAKRERVWVVKPSPGPHAID 40  Candidatus Korarchaeum cryptofilum OPF8
WP_013129725       4 MGGSKHLKSIAAPRYWPILRKEYKWVVKPSPGPHAIa 40  Thermosphaera aggregans
CBRAS:FFONT_0508   4 MGGSKHLRSYSAPDFWPISTKERFWAIKPSPGPHSLS 40  Fervidicoccus fontis Kam940
WP_013413941       4 MGSRRHLKRLKSPRHWPIPRKEKKWTVKPSPGPHSAD 40  Methanothermus fervidus
Q2NFW9             4 MGSRKHLKRFKAPKMWPIHKKEEVWTTKTSAGPHALE 40  Methanosphaera stadtmanae DSM 3091
jgi:Tpen_0243      6 KGSLRHLRRSVAPPFWPIKRKEYVWTVKPSPGPHSLl 42  Thermofilum pendens Hrk 5
jgi:Nmar_0798      4 isGSKKLKRQMAPQFWGIARKDKRFVITTRPGPHKKH 40  Nitrosopumilus maritimus SCM1
ABK77502           4 iaGSKKLKRQMAPSFWGITRKGKRFVVTVHPGAHSKH 40  Cenarchaeum symbiosum A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap