Conserved Protein Domain Family
DTHCT

?
pfam08070: DTHCT 
DTHCT (NUC029) region
The DTCHT region is the C-terminal part of DNA gyrases B / topoisomerase IV / HATPase proteins. This region is composed of quite low complexity sequence.
Statistics
?
PSSM-Id: 400422
View PSSM: pfam08070
Aligned: 24 rows
Threshold Bit Score: 35.1216
Threshold Setting Gi: 260807655
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003222506 1525 KTSKTAVKSS-----DSGTDGA---ASK--NPVPAK----KKKPVKRRPfSDSEDSDSDFGQLVKK----TTAAKKSKm- 1585 green anole
XP_008117465 1523 K-PPKPKKVeii-nsDSESEFG---LPK--KIVTPKvg-kGRGAKKRKAsGSENEGEYNPGKKTPKt---PPSKKMKKas 1591 green anole
XP_015212910 1502 PPKPKKAeti---vwDSDSEFG---TPK--KTATPKg--kGR-GRKRKMsGSEDEDEYNPVKKTGR----SSANKKSKka 1566 spotted gar
XP_004074154 1487 IPAAK-AKKPdksiwDSDSDTG---SKK--SAATPKg--kGR-GRKRKGsGS--EDEYTPMKKAVK----PPGRKPQKpp 1551 Japanese medaka
XP_022047589 1494 ppAPK-AKKPdksiwDSDSDTG---SKKpaPA--LKg--kGR-GRKRKGsGS--EDEYSPMKKAAK----PVGRKpqkpp 1558 spiny chromis
XP_005459784 1492 ppAPK-AKKPdksiwDSDSDTG---SKK--PAPALKg--kGR-GRKRKGsGS--EDEYSPMKKTAK----PPGRKPQKpp 1556 Nile tilapia
XP_005804541 1487 pAAPK-AKKPdksiwDSDSDTGdtsTKK--PAPALKg--kVR-GKKRKGsGS--EDEYSPMKKAPK----PVGKKPQKpp 1554 southern plat...
XP_022523074 1513 KPTPT--KKLdtsvwDSDSDTG---AKK--TPASGKgagkGR-GRKRKPsGS-EEDEYSPMKKTGKtpssSSSRKQKKpv 1583 Mexican tetra
XP_009987878  142 KRAPKAKKVetv-nsDSDSEFG---IPK--KTAAPKg--kGRGAKKRKAsSSENEGEYNPGKKTPKs---TPSKKSKKaa 210  red-crested t...
XP_014350536 1489 KKAPKPKKTepv-dsDSDIAFG---IPK--KAALPKg--kGR-EKKRKLsVSEEEGAYQPKKKASKp---ATSKKSKKas 1556 coelacanth
XP_003222506 1586 --mDDsFSVdsDID------SPVAPRERGGRSRKPIQY 1615 green anole
XP_008117465 1592 fepDSdVDIfps-----dfaSEAASTPRTGRARKEVKY 1624 green anole
XP_015212910 1567 aseEEdFDTnnf------grSETSSRERPGRAKKEVKY 1598 spotted gar
XP_004074154 1552 sddDDd-------DsnglsaASAFSRGRQGSARKEVKY 1582 Japanese medaka
XP_022047589 1559 sddedddsnslsalsapsrdrpgrakkevkyfhesdne 1596 spiny chromis
XP_005459784 1557 sddEDdsns--------msgLSAPTRDRPGRAKKEVKY 1586 Nile tilapia
XP_005804541 1555 sddEDeDDD----EdnslstAKGPSRERPGRARKEVKY 1588 southern platyfish
XP_022523074 1584 sdeDEd-EVdss-----rfsRLDTSRDRSGRAKKEVKY 1615 Mexican tetra
XP_009987878  211 fdqDSdVEIfqs-----gfaSETAPKPRTGRARKEVKY 243  red-crested turaco
XP_014350536 1557 ffdDEdNDLndNDNfrstygSEPASRDRPGRARKEVKY 1594 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap