Conserved Protein Domain Family
K167R

?
pfam08065: K167R 
K167R (NUC007) repeat
This family represents the K167/Chmadrin repeat. The function of this repeat is unknown.
Statistics
?
PSSM-Id: 400417
View PSSM: pfam08065
Aligned: 84 rows
Threshold Bit Score: 98.0564
Threshold Setting Gi: 1076761203
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELW67270     1551 KITKLPCKSTQPESVDTPTSTKRRCKTSLEEVVVREELSaVSKLMQISEVTTHAPKAPVSGHKGNKASMETPKQKPYLKE 1630 Chinese tree ...
EHB12591     2126 KTPQTLC-SSQSTPVDTRTTSKRCPKTSIGKMDV-KELSfVRK--KTLRETVHTHKEA-IDDKDNEVFKESAKRKLDRAE 2200 naked mole-rat
XP_008977158 2462 KATKIACKSL-PEPVDTATSSKRRLRTRAQKVEVKEEPLaGGQLPPASGETTHTDKEPAGEGNGVKAFKQPSKRKLDPE- 2539 white-tufted-...
EHB12591     2487 KTTKMPCKSSQPEPVDAPTSTKRQLRARLGNVNVKEGLLvVRKPTRTSRAITHTSKVPEGEDKDIKAFKESSEQALDPTT 2566 naked mole-rat
XP_010619045 2866 KTTKMPCKSLQPVLADSPTSTERQLRPRLRNVNVREGLLaMRKPTRMSRATTHTSKVPEGDDKDIKTFKESSEQTLDPAT 2945 Damara mole-rat
BAE02443        5 KTTKIPCKSS-PELVDTATSSKRRPRTRAQKVAVKEELLaVGSLTQTSGETAHTDKEPVGEDKGMKAFKQPVKRKLD-AE 82   crab-eating m...
ERE79207     1167 KLTKMPHSSLPPEPTETSITSQRQPRTRLMKVHVKNELSgDRMLPQMSQEIMDISRVPEGEDKGISTRKQSVKRKLDTAV 1246 Chinese hamster
EHB12591     1628 ETTEMSSRFIQPGSLNTPATSKRRPKISLEKADR-KEMSaLRKLMQTTGEAISTSKVLEGDDK---VFKDFVEQKLIPVP 1703 naked mole-rat
XP_027264901 2045 KRTSVSLKSPQPVLVRTTQTSERLAKTSLGKVGVREEIS-LNMPRCAAGESVHIPSLPEDDGRGKKDLKKSRTQTLGPSA 2123 Chinese hamster
XP_027264902 2570 KTAKVSLESVQAEPVRTPVSTKRLSKTGLDKVDAREKHSlLSKPRCSSQEVMRVSRLSEDDGSGTKDLKESAAQALDPAI 2649 Chinese hamster
ELW67270     1631 NLSGHKRSPRTPKEKTQPLEDLSGFTELFQTP 1662 Chinese tree shrew
EHB12591     2201 NGPGTKRLQRAPKEKDQALEDLGGFQEFFQMP 2232 naked mole-rat
XP_008977158 2540 NVIGSRRRPPAPKEKAQPPEDPASFQELSQTP 2571 white-tufted-ear marmoset
EHB12591     2567 SVTSNRRYPRASKAKSQ-VEDLPSPKEISQIP 2597 naked mole-rat
XP_010619045 2946 RATSSSRYSRASKAKSQ-VQDLPTPKEISQTP 2976 Damara mole-rat
BAE02443       83 DVIGSRRRPRAPKEKAQPLEDLASFPELSPTP 114  crab-eating macaque
ERE79207     1247 SVPSSKRQRVARAEKAQTLEGLPGFQELSQTP 1278 Chinese hamster
EHB12591     1704 --TSNKRQPKKRKEKVPPLEDLVGFQELFQTP 1733 naked mole-rat
XP_027264901 2124 SVTRSKKQQGSHKERSQSPEDLFGLQELFQTP 2155 Chinese hamster
XP_027264902 2650 SVTRSKRQRGACKKRSQSPEDLFGLQELFQTP 2681 Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap