Conserved Protein Domain Family
IlvB_leader

?
pfam08049: IlvB_leader 
IlvB leader peptide
This family consists of the leader peptides of the ilvB operon. This region encodes a potential leader polypeptide containing 32 amino acids, 12 of which are the regulatory amino acids valine and leucine. A model for the multivalent regulation of this operon by valyl- and leucyl-tRNA is proposed on the basis of the mutually exclusive formation of five strong stem-and-loop structures in the leader mRNA.
Statistics
?
PSSM-Id: 369669
View PSSM: pfam08049
Aligned: 3 rows
Threshold Bit Score: 26.4752
Threshold Setting Gi: 123561079
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAR46889      1 MIITTLLQTLRLTAHIAAVVVVRVVVVVGKAP 32  Proteus mirabilis HI4320
Q329E0        1 MTTSMFNAKLLPTAPSAAVVVVRVVVVVGNAP 32  Shigella dysenteriae Sd197
WP_002923286  1 MNATLIASTLLKTAP-AAVVVVSVVVVVGNAP 31  Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap