Conserved Protein Domain Family
Op_neuropeptide

?
pfam08035: Op_neuropeptide 
Opioids neuropeptide
This family corresponds to the conserved YGG motif that is found in a wide variety of opioid neuropeptides such as enkephalin.
Statistics
?
PSSM-Id: 400404
View PSSM: pfam08035
Aligned: 11 rows
Threshold Bit Score: 52.0615
Threshold Setting Gi: 223344
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_019206385 182 YGGFMKSWDERSQRPLITLFKNVINKEAQE 211 Nile tilapia
XP_005804791 175 YGGFMKSWQEHSKRPLITLFRNVINKDGEE 204 southern platyfish
XP_015462537 169 YGGFMKPWSEKSSKPFITLLRNIIVKDGQ- 197 Mexican tetra
Q5SPP4       184 YGGLMRPYLDESHKPLITLIRNAIGNGQQF 213 zebrafish
ALD51514     177 YGGFMRSWDERDPRPLLTLLKNVLNTEGRQ 206 three-spined stickleback
Q7ZT18       190 YGGFMKSWDERAQKPLLTLFKNVMHKDQPR 219 zebrafish
ARO50390     369 YGGFMVS--EKSHTPLMTLFRNAIIKNAPD 396 fat-tailed dunnart
XP_010706370 219 YGGFMSL--EHSQTPLMTLFKNAIVKSAYK 246 turkey
XP_003227954 210 YGGFMTS--ERSRMPLVTLFKNAIVKTPYK 237 green anole
XP_006002164 222 YGGFMRSWDERSQKPLMTLFKNVMIKDGHE 251 coelacanth
0709227A       1 YGGFMSS--EKSQTPLVTLFKNAIIKNAHK 28  horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap