Conserved Protein Domain Family
TES

?
pfam08034: TES 
Trematode eggshell synthesis protein
This domain has been identified in a number of distantly related species of trematodes. This protein domain is crucial for eggshell synthesis in trematodes (Ebersberger I).
Statistics
?
PSSM-Id: 400403
View PSSM: pfam08034
Aligned: 5 rows
Threshold Bit Score: 71.7407
Threshold Setting Gi: 1084310388
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_018645369  88 KAKGKFRSRGLGRHGIVSSESTYYVIEGKFDRYGRkRPTNSKFKTRGKEKKYSKKIVDNQFDIQGGL 154 Schistosoma mansoni
P16463        96 YRNDQIQSRGNSAKGGSYSESTYFTLHSGTDRYGR-RNDYSRFQTRGRSNGYRENMFLNVFDVVGNI 161 Schistosoma mansoni
XP_018646333  90 ryEGLFFSRGYSIYGDIDSETTTFQYGGKITKYGKrRRKYSDRDTIGSSDRYASSYIKDDFRIRAKt 156 Schistosoma mansoni
XP_018645365 101 YTKGYQTFLGKRRRGSKSHVRTTFRRRSGYDYNGR-KERSSTFESYGEADSFDRKKIRDVFDVNGyi 166 Schistosoma mansoni
XP_018646330  64 HTQGKFIAYGNADKGLKYHQTTYFHKGSKY------QKKFANYDTKGKVHSYGKQNVKAKFNIESKL 124 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap