3AFE


Conserved Protein Domain Family
Acyl-CoA_dh_2

?
pfam08028: Acyl-CoA_dh_2 
Click on image for an interactive view with Cn3D
Acyl-CoA dehydrogenase, C-terminal domain
Statistics
?
PSSM-Id: 400399
View PSSM: pfam08028
Aligned: 20 rows
Threshold Bit Score: 82.3632
Threshold Setting Gi: 81720214
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AFE_C          240 TISAPIVGMAYGAYAAHVEHQG-KRVRaAFAGEKAKDDPFAKVRIAEAASDIDAAWRQLIGNVSDEYALLAAGKEIPFEL 318 Mycobacteriu...
Q8XT96          241 SIAAVALGIAHRAIESLIDLSK-QKTP-QGSTRPLAERSGTQLAIAYCSARLRAARAFLHEVLEDTWAVSKGSDPIAVSH 318 Ralstonia so...
O05773          224 SIGAAALGNARAAIDDLVELAG-GKKG-LGSTRTLAERSATQAAAATAESALGAARALFYEVIEAAWQVSHDAEAVPVTM 301 Mycobacteriu...
Q73ZE7          242 GHASWALGVAKSMLDDVQELAA-TKFR-MSDMASLASRPTFQKGLAHHRAAWRAARLLVLDAFTTAEAAVAAGQELTPAL 319 Mycobacteriu...
Q89IL9          247 VHGAFVVGMAESTVDELLALANtGRQQ-LYAAVPMRESEIFQYELGRISAELGAAQAFHEVQAASHWRHALAGTLNDEDL 325 Bradyrhizobi...
Q8XTR8          250 SVAAAALGFARRALDEALARAT-TRKM---FNGVLADFQLTQAKLAQMATAIDSAALLTYRAAWQ----RDQGRSV---- 317 Ralstonia so...
Q81JV7          244 GIGAQALGIAEAALACAIDYAK-EREQ---FGKPIAEQQGIGFKLADMATSVEAARLLVYRAASL----RAQGLPC---- 311 Bacillus ant...
Q2YK78          243 GIAAQAVGMARAAFEAARDYAR-ERIT---FGKPIIEHQAVAFRLADMATRIETARQMVLHAAAL----REAGKPC---- 310 Brucella abo...
CAS:CtCNB1_1356 246 aVSTACLGALESAIASFTERAT-AHVG--KHGNRMAEDVNAQTAVTEATIALDQLKMVLFRNYARIVDAAKTGIQLTLEE 322 Comamonas th...
Q82NJ4          253 WSAPVALGLARAAVAEFTERIH-RRGItYTFHERQNEATVTHLQVAEAEMRVGGAELHLARLTAEIEAKARDDLPYTPLE 331 Streptomyces...
3AFE_C          319 RARARRDQVRATGRSIASIDRLFEASGATALSNEAPIQRFWRDAHAGRVHAANDP 373 Mycobacterium tuberculosis
Q8XT96          319 RRDIRLAATFATTESASVVDRMHRLAGGSAVYQASPIQRCLRDIHVATQHIMVSE 373 Ralstonia solanacearum
O05773          302 RNRLRLAATHAVRTSADVVRSMYDLAGGTAIYDNAPLQRRFRDAFTATAHFQVNe 356 Mycobacterium tuberculosis
Q73ZE7          320 RADMRVAAVYATDTARGCAEWAHLVAGTSSIREGSRLERAFRDIYTGTQHAFISE 374 Mycobacterium avium subsp. paratuberc...
Q89IL9          326 VVEGTRSATWLATTCVGIADACFSLAGSSAVYDSSPLQRRLRDLHVAAQHAHAQQ 380 Bradyrhizobium japonicum
Q8XTR8          318 TREAAMAKMTATENAQQVIDAAVQMWGGLGVVSEQPVERLYREIRALRIYEGATE 372 Ralstonia solanacearum
Q81JV7          312 GKEASIAKLFASKTAVEVAIEAVQVFGGYGYTKDYPVERFFRDAKITQIYEGTSE 366 Bacillus anthracis
Q2YK78          311 LTEASMAKLVASEMAEQVCSAAIQIHGGYGYLADYPVERIYRDVRVCQIYEGTSd 365 Brucella abortus 2308
CAS:CtCNB1_1356 323 RLLQRAQASYVPKLTGFHANELMRACAASGTFKNNPIERIFRDIHQGRTHIANNt 377 Comamonas thiooxydans
Q82NJ4          332 RARIRAESGYVTRICREAVDLLAAASGASSLHQEVPMQRITRDIHALCLHSFVNP 386 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap