Conserved Protein Domain Family
Albumin_I

?
pfam08027: Albumin_I 
Albumin I chain b
The albumin I protein, a hormone-like peptide, stimulates kinase activity upon binding a membrane bound 43 kDa receptor. The structure of this domain (chain b) reveals a knottin like fold, comprise of three beta strands.
Statistics
?
PSSM-Id: 369655
View PSSM: pfam08027
Aligned: 2 rows
Threshold Bit Score: 64.1916
Threshold Setting Gi: 357514193
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003627385  29 CSGICSPFQMPPCPSSNCRCIPLVLAGGNCVDPSS 63  barrel medic
KYP36216      39 CSGVCSPFEVPPCGSRDCRCIPVGLFVGYCTYPSG 73  pigeon pea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap