Conserved Protein Domain Family
Antimicrobial_5

?
pfam08026: Antimicrobial_5 
Bee antimicrobial peptide
This family consists of antimicrobial peptides produced by bees. These peptides have strong antimicrobial and some anti-fungal activity and has homology to abaecin which is the largest proline-rich antimicrobial peptide isolated from European bumblebee Bombus pascuorum.
Statistics
?
PSSM-Id: 369654
View PSSM: pfam08026
Aligned: 6 rows
Threshold Bit Score: 39.0063
Threshold Setting Gi: 915663052
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KYQ52474 22 SPVRKPPPGGWKPFPTFPGQGRYNPQIRFPH 52  Trachymyrmex zeteki
EGI68768 22 SPVRKPPAGGWKPFPTFPGQGPYNPKIRFPH 52  Panamanian leafcutter ant
P15450   21 VPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQ 51  honey bee
KOX74422 22 VPSSNIPPQRRRPFPTFPGQGPFNPKINLPR 52  Melipona quadrifasciata
EZA47299 22 PPVQRPPPGSWKPFPTFPGQGPFNPRIKFPY 52  clonal raider ant
KOC65420 22 SPVQRPGPAT---FPTFPGQGTFNPKVGWPY 49  Habropoda laboriosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap