Conserved Protein Domain Family
DUF1704

?
pfam08014: DUF1704 
Domain of unknown function (DUF1704)
This family contains many hypothetical proteins.
Statistics
?
PSSM-Id: 400394
View PSSM: pfam08014
Aligned: 45 rows
Threshold Bit Score: 352.291
Threshold Setting Gi: 315590403
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q88MS0          53 QGFLKAKGKEPPAVDRAyyqsrPLSFDSSAVKAEFQGIERDIIRQlgqfNPVGQIMKRMCREYRMVVRMLEARGTE--DF 130 Pseudomonas p...
Q7MGD9         329 KRFEAAPNRYTPDYRYR-----QLPIHANEFKHQLYRLPIETIAD----PDMRQLYSDMVNNLSEKIDLLTSVGQE--AF 397 Vibrio vulnif...
SDU:GNIT_2760   45 KTFFDSHFSIEPEFTYD-----GSKLDVFATKRKLLNLPLENVVD----EDLSEIYFDTINSYLDKVDQFNSIGTN--DF 113 Glaciecola ni...
Q7MNN5          47 QRFFDNRFSIEPSFTYK-----DQTFDVHQAKRNLYSLPIENIDS----VKLRALYAEVIQSYADKLDQLCSIGNA--EF 115 Vibrio vulnif...
Q87S99          47 ERFISNKYSQEPNFQYQ-----KAPLDTHQSKRRLYELPLEHIED----TQLQKLYEDVIQSYADKLDQVNTIGTQ--EF 115 Vibrio paraha...
kribb:DDD_3069  46 KEFFKSKYTHEPKFKYR-----KLKFKPYKLHRMFFSQRLERIED----EDIRSLYKDIIYTYSGLVQCIETISESnsKF 116 Nonlabens dok...
EAR15576        47 HRFFASKFTEEPQFKYP-----KLKFDPYKLHRLFFSHRLDRIED----PVIRDMYKEVIYFYANMVQCIETIGHGk-RF 116 Robiginitalea...
WP_013307029    47 HRFFASKYTENPQFNYP-----TLKFNPYKLHRLFFSQRLERIKD----EHIKKLYQQVIYYYSNMIQCIETIGTPr-RF 116 Maribacter sp...
Q6LH86         323 RRFLHNPYSYQPQFTYR-----QLDLDPYKFREQLYRLPVEDIRD----ADIQKLYRKVIDQLAIRIDLLTNIGTD--EF 391 Photobacteriu...
jgi:UWK_00573  322 KRFFAKQCSYTPQFRYR-----QLKIDPFAFRKKLYAIGVDTIQD----VSIRQLYRSTIDMLAQKVDLLTTIGTD--SF 390 Desulfocapsa ...
Q88MS0         131 GLISQELYGAASDafhagdpTLADLGLMLSDYLNNiDGRGDLKDEPKNLTAKEAVEILQHRLNNVfgeaEGTIRVFESDG 210 Pseudomonas p...
Q7MGD9         398 LYNSLRHYGRPDG-------VDISNAQFLLYA------QTLDEEHGALFTAQQAQTQMQQAAKGW----EMPCKVSLSSS 460 Vibrio vulnif...
SDU:GNIT_2760  114 IYDSLRYFGEPTQ-------KDIGNAKFILHL-----PGNLNEENEEVLKFEEIKQILVDFAEVN----ELPYNLKIEEN 177 Glaciecola ni...
Q7MNN5         116 LYNSLRYYGEPSS-------KDIRNANFLLHL-------PIEEEASQRHDCHEIAAFMQQFCQDH----GYTGEIEINNS 177 Vibrio vulnif...
Q87S99         116 LYNSLRYYGEPSA-------KDIANAHFILHL-------PTEEESKPEHDSRSIAHFMQSFADKN----GYECEIQILDG 177 Vibrio paraha...
kribb:DDD_3069 117 YFNSLRFFGTPTE-------KMVENAKFILHFQNE---ELVEKKHDAILSTEEAEAFFINYRELY----DFDFTIKTSSA 182 Nonlabens dok...
EAR15576       117 YYNSLRVYGTPTE-------KDVENARFILHF----EDEPAFGNMEKRHSPEAARAYFEKFAKQY----DFPLDIRFSTH 181 Robiginitalea...
WP_013307029   117 YYNSLGVFGTPTE-------KDVQNARFILHF----PDEPTSSDMEKIYSAEEAKSYFEAFSKQY----DFPLNIKFATH 181 Maribacter sp...
Q6LH86         392 LYNSLRYYGQPDE-------RDIANANFILHA------CEYQEPPEATISAAEAIQAFKDAADDY----GITCKVVGSKQ 454 Photobacteriu...
jgi:UWK_00573  391 LYNSLRFHGEPSE-------ADIELARFLIAA-----PPIEKEKNPKLLSARECANVFKRAENDY----GFSFQVELSSR 454 Desulfocapsa ...
Q88MS0         211 IVADAAAGADY--IKVRADAMFNARDVRALEVHEGLVHVGTTLNGLNQPiCTFLAKGPPSSTVTQEGLAILMEVIAFASY 288 Pseudomonas p...
Q7MGD9         461 LAARAMVSSNPptLLLNGKVTFHDTELRRLIQHELGVHMATTFNAKMQP-LQVFRLGLPGDTLTQEGLAIMAEYHSGYLS 539 Vibrio vulnif...
SDU:GNIT_2760  178 MIANALVSGNT--IKLNKNAKLSISDTNALAQHEIGVHLVTTLNARKQP-LRILEIGNPLNTMTQEGLAILSEYLSDNLT 254 Glaciecola ni...
Q7MNN5         178 MIANALVSGTK--VKINASASITTKEMHALAHHELGVHLLTTLNGRAQP-LKLLSLGCPVNTTTQEGLAILCEFLSGHFS 254 Vibrio vulnif...
Q87S99         178 MLANALVSGSR--VKINSAAHITTDELEALAHHEMGVHLLTTLNGRQQP-LKVLSLGCPANTNTQEGLAILCEYLSGHFS 254 Vibrio paraha...
kribb:DDD_3069 183 MSAAAMVSNKDrsLILKKGHLYSQHELNVLAHHEIGVHLVTTFNAIDQP-LKIFSNGFPNNVETQEGLAVMSEYMSGNLT 261 Nonlabens dok...
EAR15576       182 IAAEAMVSNSSrsLLIKRNARFSDNQLLTLAHHEIGVHLVTTFNGLAQP-LKIFSNGLPKNVETQEGLAVFSEYMGGALT 260 Robiginitalea...
WP_013307029   182 LSAEAMVSNSSqtLLLKKNTKFSKNQLLTLANHEIGVHLVTTFNGALQP-LQIFSNGFPKNVETQEGLAVFSEYMGGALT 260 Maribacter sp...
Q6LH86         455 LIARAMVSGRS--IKVNTGCMFSQRDLDALIHHELGVHLVTSVNADAQP-LKVLKLGLPGNTHTQEGLAILCEFLSGSFP 531 Photobacteriu...
jgi:UWK_00573  455 IVARAMVSSGRrkVMINRNAQFTEVEIQALIHHELGVHMVTTSNARQQY-LKIFRMGLPGNTETQEGLALLSEYLSGNLT 533 Desulfocapsa ...
Q88MS0         289 PSRLRKLTNRTRAIHMVEEGADFMQVYGFFREQ-GFEMAQSYSNASRVFRGSvpnglPFTKDLSYLKGFIMVYNYIQLAV 367 Pseudomonas p...
Q7MGD9         540 HARLQALAVRVLAVDSLLKEHNFYQTFCFLTDElQLERDDAFIITTRVYRGG-----GFTKDYVYLKGFLAMLDLSKQ-- 612 Vibrio vulnif...
SDU:GNIT_2760  255 IKRLKILALRVVAVQSMIKEKSFRKSFLLLKEEyGASNDIAFAVCSRIYRGG-----GFVKDYLYMQGFHKMLNAYENE- 328 Glaciecola ni...
Q7MNN5         255 LKRLRTLALRVIAVESMIKDRDFRNTFLLLKEQyKTDDMTAFTITARVYRGG-----GYTKDYLYLRGFREILNAYDQLG 329 Vibrio vulnif...
Q87S99         255 IKRLRTLALRVLAVESMIKERDFRHTFMLLKEQyKASDVQAFTITSRVYRGG-----GLTKDYLYLRGFREVLNAYDKLG 329 Vibrio paraha...
kribb:DDD_3069 262 LNRLKELAYRVIATDSLIKGYSFADTFDLIHSQyKLDRERAFNITLRTHRGG-----GFTKDALYLSGLKKIYDLHKSN- 335 Nonlabens dok...
EAR15576       261 LKRLKEISYRVLASDSLSKGYSFADTFDLIHNQyKLDRDAAFTITLRAHRGG-----GFTKDRLYLSGLRKIYKRYLRE- 334 Robiginitalea...
WP_013307029   261 LKRLKELSYRVLASDSLIKGYSFSDTFDMIHNQyKLNREEAFTITLRAHRGG-----GFTKDRLYLSGLRKIYKRYLKE- 334 Maribacter sp...
Q6LH86         532 LHRLKTLALRVIAVDMMVNGDSFGTTFNALKHVhKLSDDDAFTITMRAYRGG-----GFTKDFLYLRGLKDAIHAYKQ-- 604 Photobacteriu...
jgi:UWK_00573  534 LARLQSLAHRVMAVHMMVKNYDFPRTFKALSDDyGLSREDAFNLTVRVYRGG-----GFTKDYLYLTGLRKALQLYRSG- 607 Desulfocapsa ...
Q88MS0         368 kkgklEQIPLLFCGKTTLEDMRTLRQLVEEGLVEPPKYLPEQFRDLSALSAWMCFSNFLNH 428 Pseudomonas putida KT2440
Q7MGD9         613 -----RSLDNLMIGKCSHRYLDLIDELVERGWLTQPRHRIP--QHQGDIEPTLAYLIRSLk 666 Vibrio vulnificus YJ016
SDU:GNIT_2760  329 -----PNFDLLFTGKTSIDYLPQITNLIEKGILQKPQYVSTIFKQPESLSEIKQYIAhaik 384 Glaciecola nitratireducens FR1064
Q7MNN5         330 -----DDFNLLLAGKTEIRYFSTIKSLVADGLIQPPKFISPAIAKPAPADPIYKFVANALk 385 Vibrio vulnificus YJ016
Q87S99         330 -----DDFSLLLCGKTELKYFDLIRSLVNKGIFTQPKFISPALSTPKQTNPIHRYIVSALk 385 Vibrio parahaemolyticus
kribb:DDD_3069 336 -----TNFDNMLLGKCSLEYNPIIEKMKGLNLVLPAAHHAKSFDVQLNNNPTIDFILNNLK 391 Nonlabens dokdonensis DSW-6
EAR15576       335 -----ESMDRMLTGKVALDFEKQIAYLQDIGLAVKGPHDCLSFRDKRNTNPTLDFILNNLK 390 Robiginitalea biformata HTCC2501
WP_013307029   335 -----DSMDSMLTGKVTLEFEDSIKYLQHLGLATTITHKNIAYSQNLNTNKTLDFILNNLK 390 Maribacter sp. HTCC2170
Q6LH86         605 -----GDLTSLFVGKTGFESKSLLDELIAREILKKPTYIPKALSIKKEPNPVMDFLINSIK 660 Photobacterium profundum
jgi:UWK_00573  608 -----TDLQPMFVGKTSIAFLDTLKEMLGRDVVSNPLHLPRAWQMKVQSSPILDYLLSsfg 663 Desulfocapsa sulfexigens DSM 10523
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap