Conserved Protein Domain Family
T4SS

?
pfam07996: T4SS 
Type IV secretion system proteins
Members of this family are components of the type IV secretion system. They mediate intracellular transfer of macromolecules via a mechanism ancestrally related to that of bacterial conjugation machineries.
Statistics
?
PSSM-Id: 400383
View PSSM: pfam07996
Aligned: 39 rows
Threshold Bit Score: 107.063
Threshold Setting Gi: 500123403
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:CHAB381_0179      27 GIPV-VDAAANAQMTTQNLKQIAewakeakrwvdTTTHYSAQLNAYAKQL-------ATQSGVrdvTSFLEEAKdVYD-- 96  Campyl...
Q07GT2                 27 GVPV-IDTTAIAQFVAQLDQARQ-----------AYTVQLQELTNLENQLas----mIGPRAI---SAILNDVTeIQKrv 87  Roseob...
WP_000857358           22 GIPVaVDADPMRDVqwaqel---------krwmeTARHYQSQIQAYKDQL-------ATATGVrdiADFVDQAKgLKA-- 83  Entero...
ACQ67974               26 GILV-FDATSKMENARqwakea-------kqwmeTVEHYKAQMNVYKDQL-------ATSTGLrdiQGLLEQGKsLQS-- 88  Candid...
WP_013318594           22 GIPV-FDAVSNTESINqwmqkl-------kqwqeTVTHYKDELDAYKQQL-------ATATGIrdiQGFLREAKsLKG-- 84  Dickey...
WP_015696806           22 GIPV-FDAVQNTESMNqwiqkl-------qqwqeTVTHYRSELDAYKQQL-------ATATGVrdvQAFLREAKsLKT-- 84  Rahnel...
Q6D6R1                 22 GIPV-FDAVQNVESINqwvqkl-------qqwedTVTHYKSELNAYKQQL-------ATATGVrniQGFLSDARsLKT-- 84  Pectob...
calssnu:BYI23_F000710  26 GIPT-FDAASFLQLQQ------------------QLTQLQDQYKTLKDQYaa----iTGTYGRgsiG--LNQSIsAASvv 80  Burkho...
jgi:Thimo_3754         26 GVPV-IDASNLAQAVAQVQALAD-----------QLTTLQDQLNTLRDQYttitnmyNEMRGItghALMLPNPV---Dal 90  Thiofl...
WP_011930790           26 QVPV-IDSASLAQIVNQLNEAKQ-----------QYSELVSQYNELKSTYna----lSQNVNPnqwAQQLDQSA-MQDtv 88  Acidip...
tigr:CHAB381_0179      97 ---------EAKKVGTTLGelkdfknsgKDSISSKVKKLMDKFfey-----dycKDIVDVdkttqNICYQKRSANIEDIV 162 Campyl...
Q07GT2                 88 sa---tslnEIQDAVLSGTal-----tdLAELNDAISDIRNRFdla------glNDIFTSlepidAAITEQATAGVAAIA 153 Roseob...
WP_000857358           84 ---------DLEKLRKPGQalnd--lllSGGSSGQFDALYEKYkifd----tcnTAQSGSy---aNVCKQQVINKAIQLE 145 Entero...
ACQ67974               89 ---------EIKTLQNQGIslnd-lltsDNPPRGALDSLYHKYksfdv--cgdsTSSSKLpasylNACKQETANKGYMIE 156 Candid...
WP_013318594           85 ---------DIDALRKNGIslddlltnpDGSYSSALQGLYKKYqsf------dscNPSRSslryqDSCKQLLLNQALAIE 149 Dickey...
WP_015696806           85 ---------DIDNLRQNGIslddllsnqSGSYSSELNSLYNKYksf------dtcNPSSAsprylDSCKQMILNQAVAIE 149 Rahnel...
Q6D6R1                 85 ---------DIDNLRKNGIslddlltnhNGSYSSELQHLYSKYksfs---vcstEQEGIKsqtltDSCQQMVLNQAMAIE 152 Pectob...
calssnu:BYI23_F000710  81 pg----swqEVVSQQQGGA---------FGSKQGFYEKLINTMppdl----fadPQAQSA-----TTYKMSTDSVRAALA 138 Burkho...
jgi:Thimo_3754         91 hdflpaanlDPDDLL-------------SGPLAALANSLRDANelysaaelfggTHLTGAa----RQYQERSDFIFSYMA 153 Thiofl...
WP_011930790           89 pnt--silpNMLDGISPPSs-------lSGNVGSLAQQYYNMNkvyipa----------gsdfgsKQIQQGANETANFEA 149 Acidip...
tigr:CHAB381_0179     163 FYKERSDTIGMYSKNINKLAKKLQKSKDIKESSDLNNAIQAQVALMQAEKIQIDLYAKQRENSKNIME 230 Campylobacter homi...
Q07GT2                154 TAEDTYVRANDAMDRINTMITGIDGNADLKASIDYNTRVMAELAVLLNENLRVQAAATNVAGANALAQ 221 Roseobacter denitr...
WP_000857358          146 QTDEVQNQVSQTLGEINSLSNRVALAKDSKESQDLANSIQLKSVMLNTLTTQWEMSVKAAEKRENALE 213 Enterobacterales
ACQ67974              157 QTAEVQKKINVALKDIGHLSHRIANAKDSKESQDLANAIQARSVQLNSLTSAWEMNIKAAEQRDKLLS 224 Candidatus Hamilto...
WP_013318594          150 NTREVQDRITSTLNDIADLSDRITNAKDSKESQDLANAVAAKSVQLNALTSQWEMSVRQTEQRATLLE 217 Dickeya dadantii
WP_015696806          150 NTSEIENKITGTLGDISDLSDRIANAQDSKESQDLANAIAAKSVQLNALTSQWEMSVKQTEQRTVLLE 217 Rahnella aquatilis
Q6D6R1                153 NTAEVENKITGTLSDISALSDRISNAQDSKESQDLANAIAAKSVQLNALTSQWEMSVKQAEQRTTLLE 220 Pectobacterium atr...
calssnu:BYI23_F000710 139 GGDSLYSEVQAHLNNLSVLSAQVDTTTNIKDAQDLQNRISSENGMLSSAMAKLNAMNMNLQA-NLVNQ 205 Burkholderia sp. YI23
jgi:Thimo_3754        154 LAKEAYENIAARRATLEGFATAAGTATTEKAILDLNARIAAENALLLNDLAQLQALQIMAQMQEQNLv 221 Thioflavicoccus mo...
WP_011930790          150 IATQNLQSLEAREQELPQIQSQLNSATTIQQVASIQARLSAEQNYVQAQQAQAQNLQLLAFEENRAGQ 217 Acidiphilium cryptum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap