Conserved Protein Domain Family
NAD_binding_5

?
pfam07994: NAD_binding_5 
Myo-inositol-1-phosphate synthase
This is a family of myo-inositol-1-phosphate synthases. Inositol-1-phosphate catalyzes the conversion of glucose-6- phosphate to inositol-1-phosphate, which is then dephosphorylated to inositol. Inositol phosphates play an important role in signal transduction.
Statistics
?
PSSM-Id: 400381
View PSSM: pfam07994
Aligned: 83 rows
Threshold Bit Score: 356.491
Threshold Setting Gi: 334108000
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8I3Y8               80 LGVLLVGIGGNNATTMLGGICANAKDLSYMNkcdlkrsnylGSVFLSSNIRLGYNEkDkehAYAPIYKLIDIYNPENI-V 158 Plasmodi...
WP_013445918         12 LGILLPGM-GAVATTLIAGVLASRKGLSKPI----------GSLTQMGTIRLGKRTdK---RNPLIKDFVSLANLDDV-V 76  Paludiba...
WP_014217577         12 LGILLPGL-GAVASTMIAGVIASRKGLAKPI----------GSYTQTGHIELGEGKgD---RYPLIKDFVPLASLEDV-V 76  Niastell...
CDE57758             13 LGVMVVGL-GAVSTTFMTGVLMTRKGLAKPV----------GSMTQYDKIRVGKGAdK---KYLHYKDIVPIADLNDI-E 77  Prevotel...
CCX67001             13 LGILCVGL-GAVSSTFITGVLMIRKGMGKPI----------GSITQMAKIRVGRGDkA---EYKHVSEIVPMPTLDDI-V 77  Prevotel...
CCY16111             13 LGVLCVGL-GAVSTTFIAGSLMCRKGMGLPG----------GSITQMAKIRVGRGDkK---TYKRVGEIVPLADLKDF-E 77  Prevotel...
ASM67271             12 LGVLVVGVGGAVATTMIVGTLASRKGLAKPI----------GSITQLATMRMENNEeK------LIKDVVPLTDLNDI-V 74  Bacteroi...
jcvi:cds.PERMA_1920   1 MKLWLFGLYGIVATTAVAGDRAVKKGITDTT----------GLVSSLPVFKD-----------------LERYSPLNFdQ 53  Persepho...
Q9Z4Y8                3 TGIWLVGARGSVATTTVVGAAALRAGLVPAT----------GCVSALEAFDG-----------------VPLPGFDEL-V 54  Streptom...
jgi:Isova_2168       26 TGLWLVGARGSVATTATLGLAALAHGDAAPT----------GCVTAQPAFDG-----------------VPLPAFADL-V 77  Isopteri...
Q8I3Y8              159 YGGWDINNMN--LKDCLVR----NKVFDNEVIEKIKDDLDYV--PLKSVYFKgNFI-AGNQQRRVNNILYGKNKLEILEQ 229 Plasmodi...
WP_013445918         77 FGGWDLFTDN--AYETANK----AGVLEKSDIEPLKDELIKIk-PMTAVYDH-KYL-VNLTPNNIKEGP---TKMDLAQQ 144 Paludiba...
WP_014217577         77 FGGWDIYEDN--VYEAASN----ARVLDQQLLKAIRPELEAIk-PMKAVFDR-NYV-RNLDGTFIKQSA---NKWEAAQE 144 Niastell...
CDE57758             78 FAAWDVYPAN--AYESAIN----AEVLKEKDIEPVADELKAIk-PMRAAFDH-NYA-KRLDGENYMKGA---TRWEMVEN 145 Prevotel...
CCX67001             78 FGAWDILPDN--AFESAMH----AEVLKDRDIYPVKEELEKIv-PMRGIYDQ-DYV-KAIDGTWTKDTTL--TRWQLMEQ 146 Prevotel...
CCY16111             78 IGAWDIFTDN--AYQSAMH----AEVLKPCHIEPVRDELERIv-PMKAAFDP-EYV-SRLHGENIKQAS---TRWELVEQ 145 Prevotel...
ASM67271             75 FGGWDIFPDN--AYEAAMY----AEVLKEKDLNGVKDELEAIk-PMPAAFDH-NWA-KRLNGTHIKKAA---TRWEMVEQ 142 Bacteroi...
jcvi:cds.PERMA_1920  54 FGGHEIRALDrnLYSELFShweeNQHFDYRILKELEEDLKDIkaKKGTALNCgSGVlEELKPVSTLEDEG-LSLEQIVER 132 Persepho...
Q9Z4Y8               55 FGGHDVVGTG--LVKRAEQla-eAGVVPRGLPGVLTAELDAAdaEI-----------RPAPPGTEEGGDGTPDQASAAGA 120 Streptom...
jgi:Isova_2168       78 VGGHDVSPCP--MVKRAEAlv-eAGMIAPRFLAAARPALESAdaEV-----------RTGYDPREHQG----SQQQAAER 139 Isopteri...
Q8I3Y8              230 VREQIRNFKKQNNLNELIVLWSGNTEKNIPHIPGVNDTFLNILHACKKNHES-VSPSVIYALAAILENSPFINSSPQNTL 308 Plasmodi...
WP_013445918        145 LMADIENFKKENNCSRIVVLWCASTEVYSAQTDV-HATVESLEEGLRNNDPN-ISPSMIYAYAAVKLGYPYINGAPNLSC 222 Paludiba...
WP_014217577        145 LIQDIETFKKVNNVNRVVIVWTGSTEKYLEQSAV-HETIASFEAGLKNNDPA-IAPSMVYAYAAVSAGIPFINGAPNLTT 222 Niastell...
CDE57758            146 IRKDIRDFKAAKNLDRIVVLWAASTEVYVPVDEKVHYTLAALEAAMKADDKEhVAPSMCYAYAALKEGAPFIMGAPNTTV 225 Prevotel...
CCX67001            147 AREDIRNFKEKNGCSRIVVIWAASTEIYIPRDKNVHDDLTAFEAAMKADDRQhISPSMCYAYAAMSEGAPFIMGAPNTCL 226 Prevotel...
CCY16111            146 LRDDIRTFKKAHGCERIVVIWAASTEKYIPYNEQVHKNLSDLEEAMRADDRAnISPSMCYAYAAIAEGAPFVMGAPNLCI 225 Prevotel...
ASM67271            143 LRQDIRDFKAANNCERIVVLWAASTEIYIPLSDE-HMSLAALEKAMKDNNTEvISPSMCYAYAAIAEGAPFVMGAPNLCV 221 Bacteroi...
jcvi:cds.PERMA_1920 133 IEKDILEFKD----DETVAVNVASTEPVIPYDQEVHGSLEGFERAIKENRKDrISASMIYAYVSLKNGIPYGNFTPSAGS 208 Persepho...
Q9Z4Y8              121 IVADLTGFRERLGLDRVVVVNVSSTQPPAVPHPA-HASAAALREALAR-GERpLPVSSLYAYAALRAGCAFVDFTPSTGA 198 Streptom...
jgi:Isova_2168      140 LAADVVAFRERHRLARVVVVDLASTEPPVEPLPE-HDDVDALRAALADPARTvLPPSSVTAYAAVLAGAPYAAFTPSAGM 218 Isopteri...
Q8I3Y8              309 -VSAVVQLAQQKGIFIIGNDLKTGQTKIKNFLLDFYFGTGLKPKSIVSYNHLGNNDGKNLSSDLQFYSKKVSKSNLICDY 387 Plasmodi...
WP_013445918        223 dVPAMVELSHRTNTPIMGKDFKSGQTLMKTILAPGLRARLIGLDGWFSTNILGNRDGEVLDDPGSFKSKEVSKSGVLHD- 301 Paludiba...
WP_014217577        223 dIPAIVQLANKTKTPIGGKDFKTGQTLMKTIVAPGLAARSLGVTGWFSTNILGNRDGLVLDDEQNFKTKEVSKLGVLED- 301 Niastell...
CDE57758            226 dIPAMWELAEQTKMPIAGKDFKTGQTLVKSGFAPIIGTRCLGLNGWFSTNILGNRDGLVLDEPANFRTKEVSKLSTLET- 304 Prevotel...
CCX67001            227 dIPAMWQYAEKTGTPIAGKDFKTGQTMMKTVLSTAFRTRMLGVSGWFSTNILGNRDGLVLDVPENFKTKEVSKLGVIDT- 305 Prevotel...
CCY16111            226 dIPAMWEFAEKQNVPLAGKDFKTGQTLMKTVLAPMLHTRCLGLSGWFSTNILGNRDGEVLDAPENFKTKEVSKLSVIDTI 305 Prevotel...
ASM67271            222 dTPAMWEFSKQKNVPIAGKDFKSGQTLMKTVLAPMFKTRMLGVNGWFSTNILGNRDGEVLDDPDNFKTKEVSKLSVIDT- 300 Bacteroi...
jcvi:cds.PERMA_1920 209 gIPALKELAEKNGVPHAGNDGKTGETLVKTTLAPMFAYRNLKVLGWMGYNILGDLDGKVLSHKQNKESKVVSKDK----- 283 Persepho...
Q9Z4Y8              199 rLPALDELAREQGLPYAGSDGKTGETLVKSVLAPMFARRALRVRSWSGTNLLGGGDGATLADPERVVSKNASKGL----- 273 Streptom...
jgi:Isova_2168      219 aIPALTRLAAEAGVPVAGQDGKTGQTWLRTVLAPAFAARGLRVLSWAGTNLLGGGDGATLADPENVRSKLATKSR----- 293 Isopteri...
Q8I3Y8              388 vranenlyvddekdtnvlvkksidycegdslnekgkvsadieDDCTYVESLEKQKVNSEIVIKYVPYVGDDKKAIDEYIS 467 Plasmodi...
WP_013445918        302 ------------------------------------------ILEPELFPELYGNTYHKIRIEYYPPRGDFKESWDCLDI 339 Paludiba...
WP_014217577        302 ------------------------------------------ILRPDLHPDLYGELYHKIRINYYPPHGDNKESWDNIDI 339 Niastell...
CDE57758            305 ------------------------------------------ILEADKQPDLYSNYYHKVRINYYPPRNDNKEGWDNIDI 342 Prevotel...
CCX67001            306 ------------------------------------------ILKKDEYPDLYGDIFHKVRINYYPPRNDDKEGWDNIDI 343 Prevotel...
CCY16111            306 l-----------------------------------------DKNELPELYSDIYHKVRINYYPPRGDNKEGWDNLDIFG 344 Prevotel...
ASM67271            301 ------------------------------------------IFEPEKYPDLYGDVYHKVRINYYPPRKDNKEAWDNIDI 338 Bacteroi...
jcvi:cds.PERMA_1920 284 ----------------------------------------------VVSKILGYEPYTITEINYFPSLQDNKTAFDFIHY 317 Persepho...
Q9Z4Y8              274 ----------------------------------------------VLEAELGHAVEGGVHIHHVPDLGEWKTAWDHVTF 307 Streptom...
jgi:Isova_2168      294 -----------------------------------------------GLRDLTGSDTTPLHIDNVPDLGDIKVAWDHVHV 326 Isopteri...
Q8I3Y8              468 EIFMNGKNTIVLYNICQDSMLASPILIDLILLVELSQRVFFKpnqekktnedehllneniqiedyklshtilkpkyssfk 547 Plasmodi...
WP_013445918        340 FGWMNYKMQIKINFSCRDSILAAPLALDLALFIDLAKRADMR-------------------------------------- 381 Paludiba...
WP_014217577        340 FGWLNYPMQIKINFLCRDSILAAPIVLDLALFADLAQRAGMY-------------------------------------- 381 Niastell...
CDE57758            343 FGWMGYPMQIKINFLCRDSILAAPLCLDLVLLSDLAARAGRF-------------------------------------- 384 Prevotel...
CCX67001            344 FGWMGYPMQIKVDFLCKDSILAAPLLLDLALLGDLALRAGKS-------------------------------------- 385 Prevotel...
CCY16111            345 WMGPDYGMQIKIDFLCRDSILAAPLMLDLVLCADLAARAGWT-------------------------------------- 386 Prevotel...
ASM67271            339 FGWMGYPMEIKVNFLCRDSILAAPIALDLVLFSDLAMRAGMC-------------------------------------- 380 Bacteroi...
jcvi:cds.PERMA_1920 318 QGFLGTKMKFYFTWDAVDAIVAAPLVLDIARFLNFAKKKGVK-------------------------------------- 359 Persepho...
Q9Z4Y8              308 EGFLGARMTLQFTWQGCDSSLAAPLVLDLARFMALAHRAGVA-------------------------------------- 349 Streptom...
jgi:Isova_2168      327 EGFLGSRLTLQTTWSAYDSMLAAPLVLDLARLLALAHAAGVA-------------------------------------- 368 Isopteri...
Q8I3Y8              548 nldSVLFLSSLFCKSPFNS--TVYKTRHSFFSQLESLWNFVR 587 Plasmodium falciparum 3D7
WP_013445918        382 ---GVQEWLSFYCKSPQTA--QGLPAQNDVFKQLEKLENTLR 418 Paludibacter propionicigenes
WP_014217577        382 ---GVQDWLSFYLKSPQTK--QGEPAENDIFKQLNTLKEVLR 418 Niastella koreensis
CDE57758            385 ---GIQRFLSFFLKSPMHDytQGEEAVNHLFQQYVMLKNAIR 423 Prevotella sp. CAG:873
CCX67001            386 ---GIQTWLSFYLKSPMHD--DEHEPVHDLFQQYTMLKNAIR 422 Prevotella sp. CAG:1058
CCY16111            387 ---GIQTWMSFYLKSPMHDyvKGIEPVHDLFQQFAMFKNAIR 425 Prevotella sp. CAG:755
ASM67271            381 ---GIQTWLSFFCKSPMHD--FEHQPEHDLFTQWRMVKQTLR 417 Bacteroides caccae
jcvi:cds.PERMA_1920 360 ---GVVKELAFFFKSPMDT------DEYNTHKQFETLVNWYR 392 Persephonella marina EX-H1
Q9Z4Y8              350 ---GPVPELGFFFKDPVGS------AEHDLAAQYASLAAWAR 382 Streptomyces coelicolor
jgi:Isova_2168      369 ---GPVPELGFFFKDPWAS------DTHDAAAQAAELQAWAR 401 Isoptericola variabilis 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap