3N39


Conserved Protein Domain Family
Flavodoxin_NdrI

?
pfam07972: Flavodoxin_NdrI 
Click on image for an interactive view with Cn3D
NrdI Flavodoxin like
Statistics
?
PSSM-Id: 400363
View PSSM: pfam07972
Aligned: 59 rows
Threshold Bit Score: 123.376
Threshold Setting Gi: 20178017
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3N39_C         25 VYFSSSSENTQRFIERLGL--PAVRIPLN---------Ere----rIQVDEPYILIVPSYGGGGT--AGA-----VPRQV 82  Escherichia co...
WP_003667867    8 IVYMSFSGNVRSFTHRLQEyaTQQHHLNNenpl-idllEiseetlpTESDSKFFVLLPTYMIGGSrfT-PtlteiLTTPM 85  Lactobacillus ...
Q5M6B4         29 LVYISLSGNTQSFVKRMSDylSLNHGINCrqi---nikElnh--etFQVDEPFVALLPTYLEGGNgvDNGdv-eiLTNPL 102 Streptococcus ...
Q99XX2          6 LVFISLSGNTLSFVKRLSLylADNYDYHVkqin--ikdLkh---etFPVKEEFVAILPTYLEGGNgvDSGdv-eiLTTPL 79  Streptococcus ...
Q8DXB0          6 LVYISLSGNTQSFVKRLSEqlSTWHNC-Qvsti-nikeQnh---qtFPVDQPFVALLPTYLEGGNgiDNGdq-eiLTIPL 79  Streptococcus ...
bgi:05SSU2139   7 LVYISLSGNTESFVKRLKSffQFQTDWEIelvhvkdlvKqai--pfYQLDAPFVAFLPTYLEGGNgvDNGdv-eiLTNPL 83  Streptococcus ...
Q838H6          3 LVYFSVTGQTRRFIKKLDLpaYELE-------------Pan---pfFEINEPFILVIPTYDAE------------ITEVV 54  Enterococcus f...
Q1WSU0          3 IVYFTVTGQTKRFIKKLGSnyEYFEID-----------Aan---pfFEVNDPFVLITPTYDKQ------------ITEPI 56  Lactobacillus ...
Q9CGW6          3 lAYFSVTGQTRRFVSKTNL--PNVEISPDd---------------dIEMNEPFLLITPSYAEESPtvSKSi---dVMDPV 62  Lactococcus la...
Q5FIB4          4 IAFYSITGQTERFIDKIQLkaHQIS-------------Dan---pkYDMGQKYILIVPSYQDF------------MMDSV 55  Lactobacillus ...
3N39_C         83 IRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIENVR 142 Escherichia coli K-12
WP_003667867   86 HDYLESYDNVKRCAGIIGSGNLTLGKMYVITAKTYAKEYGLPLLDAFESRGTTRDIERIY 145 Lactobacillus reuteri
Q5M6B4        103 GDFIAAHDNHKRCFGIIGSGNRNFNNQYCLTAKQYSQRFGFPMLGDFELRGTQSDIERLa 162 Streptococcus thermophilus LMG 18311
Q99XX2         80 GEFIAAHGNAQRCLGIIGSGNKNFNHQYCLTAKQYAKRFGFPLLGDFELRGTPDDISRLA 139 Streptococcus pyogenes serotype M1
Q8DXB0         80 GDFIAAHNNVKNCIGIVGSGNRNFNNQYCLTAKQYSERFGFPMLGDFELRGTSSDVERIA 139 Streptococcus agalactiae serogroup V
bgi:05SSU2139  84 GDFIALGTNAELCLGVVGSGNRNFNNQYCLTAKQYAERFNFPVIDTFELRGMQNDIERIG 143 Streptococcus suis 05ZYH33
Q838H6         55 NDFLDYKSNQELLVGVAGGGNRNFAELFVYTAKDIARDYHVPLLYSFEFSGTDEDVETFK 114 Enterococcus faecalis
Q1WSU0         57 NDFLEYQNNSHYLKGIVGTGNRNFAELFIFTAKNLSYEYHVPLIYAFEFNGTPTDVSNFK 116 Lactobacillus salivarius UCC118
Q9CGW6         63 FDFMAYNDNYKHCLGIIGTGNRNFAGIYIFTAKELSAKYQIPLLYDFEFNGTPADVAAVE 122 Lactococcus lactis subsp. lactis I...
Q5FIB4         56 VDFLTYKDNKKNIIGIIGCGNRNFNDLFAQTAKKIAATLKVPILYLLEFSGTNQDVKNVR 115 Lactobacillus acidophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap