Conserved Protein Domain Family
Swi3

?
pfam07962: Swi3 
Replication Fork Protection Component Swi3
Replication fork pausing is required to initiate a recombination events. More specifically, Swi1 is required for recombination near the mat1 locus. Swi3 has been found to co-purify with Swi1 Swi3, together with Swi1, define a fork protection complex that coordinates leading- and lagging-strand synthesis and stabilizes stalled replication forks. The Swi1-Swi3 complex is required for accurate replication, fork protection and replication checkpoint signalling.
Statistics
?
PSSM-Id: 400354
View PSSM: pfam07962
Aligned: 118 rows
Threshold Bit Score: 64.8214
Threshold Setting Gi: 209586329
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A5DWY0                         54 KVDNERVLNKPqGLPYLIKNHhRLGRI--VEqRDkkfakqelrklqsihhsyktprqlkydHEVETLGSILHFYQLW-CH 130 Lodderomyces elongisporus NRRL YB-4239...
A0BV62                         18 RLKPEQITDPQkGVVYLYNLC-KDYRF-----GN---------------------------DELDELNKYMHVIEEW-HY 63  Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00670160A  92 KADM--LTNQErGIKFLYENI-EKAKLfdKNeKGi-------------------------fDELKALDKLVNYYKGW-HF 142 Tetrahymena thermophila SB210...
XP_004997293                  130 SLDVERLLNPEnGVPYMLKTFsKHVRF--SNkPG---------------------------METRNLRLLMDHYDAW-MD 179 Salpingoeca rosetta...
XP_003288398                  217 KDRD--VLATN-GIRKLYKNL-KSSKF--SAkHS---------------------------NK-TNLELFFGIYSKW-SK 261 Dictyostelium purpureum...
ESN90387                       80 KLDVDKLKGSR-GLQALPKIF-KKVHL--KG-KG---------------------------HEAHDLDLIMTHLEHW-AH 126 Helobdella robusta...
EKC22409                       73 KLDATRLTGER-GIPILPKVF-QDVKF--KG-KG---------------------------HEARDLQIIMRYLEHW-AH 119 Pacific oyster...
EEB18228                       33 KLDYNRLSGPN-GLDLLKKMF-KNFKF--KG-NN---------------------------HEKEDLTKVMQILQHWmCN 80  human body louse...
EDV29418                       50 KLDSDRLTSER-GLRALHQQF-NKLHF--KK-KK---------------------------DYHNNLITILRIYEHW-AH 96  Trichoplax adhaerens...
TWW67602                       61 KLDSQRLISDR-GLPALRTLF-DNVHF--KG-KG---------------------------HEAEDLRLLMQKMENW-AH 107 sansaifugu...
A5DWY0                        131 GMFPKANFKDCAYLVRNLGHRsSQLRLYRRELIEKEI 167 Lodderomyces elongisporus NRRL YB-4239
A0BV62                         64 QIMPKYDFDYFTNRLQKFGGN-NSVQTHLQFLRKAHK 99  Paramecium tetraurelia
WGS:AAGF:cds.TTHERM_00670160A 143 HFMPKYSYQYFLDRCTEFGKT-SLIKTYMNNVRRIHK 178 Tetrahymena thermophila SB210
XP_004997293                  180 QLMPKMSLSNVVDTIERLGHK-AAVRTYLTDLRLSQA 215 Salpingoeca rosetta
XP_003288398                  262 EINPAISIEDSIVKIEVLGKS-KLVKNHIEDIKHGVY 297 Dictyostelium purpureum
ESN90387                      127 RLMPKIPFCEFVERMEKLGTR-KEVQTCLKRIRLDLP 162 Helobdella robusta
EKC22409                      120 RLFPKMPFDEVLERIEKLGTK-NEVKTCIKRMRLDMP 155 Pacific oyster
EEB18228                       81 CLFPSGDFEGNMEKLELIGNK-RIIQIYMKKIRMGID 116 human body louse
EDV29418                       97 RLYPKLPFVDVVHKVENLGSK-KAVQYALSLIRLGQN 132 Trichoplax adhaerens
TWW67602                      108 RLFPKLQFEEFIDKVERLGKK-KEVQTCLKRIRLDMP 143 sansaifugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap