5N0C


Conserved Protein Domain Family
Toxin_trans

?
pfam07952: Toxin_trans 
Click on image for an interactive view with Cn3D
Clostridium neurotoxin, Translocation domain
The Clostridium neurotoxin family is composed of tetanus neurotoxin and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (pfam01742), the central translocation domains and two receptor binding domains. Subsequent to cell surface binding and receptor mediated endocytosis of the neurotoxin, an acid induced conformational change in the neurotoxin translocation domain is believed to allow the domain to penetrate the endosome and from a pore, thereby facilitating the passage of the catalytic domain across the membrane into the cytosol. The structure of the translocation reveals a pair of helices that are 105 Angstroms long and is structurally distinct from other pore forming toxins.
Statistics
?
PSSM-Id: 400347
View PSSM: pfam07952
Aligned: 2 rows
Threshold Bit Score: 561.172
Threshold Setting Gi: 1431907641
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N0C_A  579 TIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPS-VISKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKIS 657  Clostridium tetani
P0DPI1  549 TMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSdYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIA 628  Clostridium botulin...
5N0C_A  658 DVSTIVPYIGPALNIVKQGYEGNFIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIE 737  Clostridium tetani
P0DPI1  629 DITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDE 708  Clostridium botulin...
5N0C_A  738 VYKLVKAKWLGTVNTQFQKRSYQMYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKNKLEEKANKAMININIFM 817  Clostridium tetani
P0DPI1  709 VYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFL 788  Clostridium botulin...
5N0C_A  818 RESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIgITELKKLESKINKVFSTPIPFSYSKnldcWVDNEEDI 897  Clostridium tetani
P0DPI1  789 NQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTL-IGQVDRLKDKVNNTLSTDIPFQLSK----YVDNQRLL 863  Clostridium botulin...
5N0C_A  898 DVI 900  Clostridium tetani
P0DPI1  864 STF 866  Clostridium botulinum A str. Hall
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap