Conserved Protein Domain Family
TPR_MLP1_2

?
pfam07926: TPR_MLP1_2 
TPR/MLP1/MLP2-like protein
The sequences featured in this family are similar to a region of human TPR protein and to yeast myosin-like proteins 1 (MLP1) and 2 (MLP2). These proteins share a number of features; for example, they all have coiled-coil regions and all three are associated with nuclear pores. TPR is thought to be a component of nuclear pore complex- attached intra-nuclear filaments, and is implicated in nuclear protein import. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerization of kinase domains or by targeting these kinases to the nuclear pore complex. MLP1 and MLP2 are involved in the process of telomere length regulation, where they are thought to interact with proteins such as Tel1p and modulate their activity.
Statistics
?
PSSM-Id: 400329
View PSSM: pfam07926
Aligned: 115 rows
Threshold Bit Score: 53.7723
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_018228833 1043 QKNELVTKIEKLKEIEESSIKAQNDYQEDLRKQFQIAQEARLSYERELIAHAEARNSLQLLRQEN----FDMKAEILSLN 1118 Pneumocystis ...
XP_005846542  938 EKQRLVAEAEAARADQAVQADQAARLREEVGLLRRQYQDAKRSYDNEVMQHGDALRRYAALETTF----NSLQQRLNEAV 1013 Chlorella var...
XP_002504866 1057 EAAEARRLAAEAEQNAAAAEGRVAALAADVEEHRKQWRQAQQMYEQELLHHAEDVKKLNAEEQRR----AEEAAAVEAAR 1132 Micromonas co...
XP_003060736 1068 EAADAIAASTAAKAAVAAAEQKVAELAADVESHRAQWRSAQQMYEQELLHHAEDVKKLNAEEARR----AEEGKALETAR 1143 Micromonas pu...
Q54JG6       1122 EKDSILAEKQQLYEKIQQLTKDQQLALDEAKLQHQLCRKATENYEREVVLHAEDIKVLPKLRDDL----VEARKTINQMQ 1197 Dictyostelium...
EFA84375      237 ERDSLIKEKQTLFKRIDELQDAQKQALEEAKIQSALAQRATENYERQLDLHAHDIKMLPTLRAEL----QEAKNVINTIT 312  Heterostelium...
EGG18269     1069 eRDVLVKEKQRLNAKIEELTKAQQMAINEASMQHDLCKKATENYERELLLHAEDIKILPTLRSEL----SESKHTIMSLS 1144 Cavenderia fa...
ESO00085      562 ELESAKEELRMVSMLKAEADERQELIKKDLEHHVADAKQAHENYERELMLHAADVEALSNIKKQL----GEAVEKLEASE 637  Helobdella ro...
4_pfamImport    1 -ILEATEKQKMLQLQADSAVQQMNSVREEMAKMKRELETTQENYERELQLHAAEVAKSSTSRREI----EEVRKTVRERE 75  
ESX02103     1007 KVGELGATIDSFDAVKKDYESQFAKLRDEMGSVQAVLREKQQ----EVAGKSDEWQQLVAEREKAqglvDELKQRVQGLE 1082 Ogataea parap...
XP_018228833 1119 KDNESFKFQLSASENSWKVLKENYEKELHDIKTRCDELVQQNNLLHTQFEN 1169 Pneumocystis jirovecii RU7
XP_005846542 1014 LELDAARVSRGQAEAEAEVSRGELQQRAAEAERRAKALGEQRDVLQQQLEK 1064 Chlorella variabilis
XP_002504866 1133 ELARAAEVRLAAAESKWADERGSMEKARRDAEAKTAALGSQNRLLHDQLED 1183 Micromonas commoda
XP_003060736 1144 EKAREASDALAKAEDAWANERGVIEKAKRDAEANAAKLASQNALLHDRLED 1194 Micromonas pusilla CCMP1545
Q54JG6       1198 IKIDSNSQELEQAKQSWIQQEQLLKQQIQELEERLKDLKHHNNLLHSQIEN 1248 Dictyostelium discoideum AX4
EFA84375      313 SKMDTGVKTFEAAQQSWEEKENLYRSQVSEFEERIKDLKHQNTLLQTQIES 363  Heterostelium album PN500
EGG18269     1145 NRVESAQKGLEVSQQSWNEQESLFKSQINEMEERIKDLKHQNNLLTSQIDS 1195 Cavenderia fasciculata
ESO00085      638 LKLKDHMIKCEAERNNWSEKEVDYKSRLNVLKEAIASTKAQNNLLHDEMwk 688  Helobdella robusta
4_pfamImport   76 SDIQILNTKVQAVENESQRQLETLQKRLEEAVEAKNSLVEQNKLLHSQLER 126 
ESX02103     1083 AQLADARADVSAAEERLEQEKQELVRELRAKEARVTELDVQNRTLINQLES 1133 Ogataea parapolymorpha DL-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap