5ZVS,2CSE


Conserved Protein Domain Family
RdRP_5

?
pfam07925: RdRP_5 
Click on image for an interactive view with Cn3D
Reovirus RNA-dependent RNA polymerase lambda 3
The sequences in this family are similar to the reoviral minor core protein lambda 3, which functions as a RNA-dependent RNA polymerase within the protein capsid. It is organized into 3 domains. N- and C-terminal domains create a 'cage' that encloses a conserved central catalytic domain within a hollow centre; this catalytic domain is arranged to form 'fingers', 'palm' and 'thumb' subdomains. Unlike other RNA polymerases, like HIV reverse transcriptase and T7 RNA polymerase, lambda 3 protein binds template and substrate with only localized rearrangements, and catalytic activity can occur with little structural change. However, the structure of the catalytic complex is similar to that of other polymerase catalytic complexes with known structure.
Statistics
?
PSSM-Id: 369599
View PSSM: pfam07925
Aligned: 5 rows
Threshold Bit Score: 2261.79
Threshold Setting Gi: 363805504
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZVS_2    4 LFNALPQPLQQLSLALAGEIPLTDHIFEQAASTWHVQPRSLTYKLLDHIPFATPVV--VPPSIYHSLDWSKCFAVNQ-DR 80  
P0CK32    1 MSSMILTQFRPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMlpIPPTIYTKPSHDSYYYIDAlNR 80   Mammalian orthoreov...
B2BNE0    4 LFNALPQPLQQLSLALAGEIPLNDELFQAAASTWHTRQRSETYHLLDRLRFSTPIV--TPQAIYRDLPWRNCYRINQ-DR 80   American grass carp...
Q8JU61    4 LFNALPQPLQQLSLALAGEIPLTDHIFEQAASTWHVQPRSLTYKLLDHIPFSTPVV--VPPSIYHSLDWSKCFAVNQ-DR 80   Golden shiner reovirus
2CSE_1    1 MSSMILTQFRPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMlpIPPTIYTKPSHDSYYYIDAlNR 80  
5ZVS_2   81 VERiPTIDNPDDVYVPNSDIGPLLTSLHTIPDYGFLHPTIENDATTLRAErARCASTFYKIASSQARQVKLdPIRMLGFL 160 
P0CK32   81 VRR-KTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQ-ARIATTYGRIAESQARQIKA-PLEKFVLA 157  Mammalian orthoreov...
B2BNE0   81 VERiPTTNASDDVYVPNSDISTLLSPLFSIPTYGTLHPSIEKDALELRADsARCASTFYKIASSQARQVKLdPTRMLEFL 160  American grass carp...
Q8JU61   81 VERvPTIDDPDDVYVPNSDIGPLLTSLHTIPDYGFLHPAIENDATTLRAErARCASTFYKIASSQARQVKLdPIRMLGFL 160  Golden shiner reovirus
2CSE_1   81 VRR-KTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQ-ARIATTYGRIAESQARQIKA-PLEKFVLA 157 
5ZVS_2  161 LLVQArprvpSGLVTDQPTRRDPTLSPALH---AIW---QVMQYYKVAGVYYAPALVVPSGAIWWIPPpgkRNVVSVQYL 234 
P0CK32  158 LLVSE-----AGGSLYDPVLQKYDEIPDLShncPLWcfrEICRHISGPLPDRAPYLYLSAGVFWLMSP---RMTSAIPPL 229  Mammalian orthoreov...
B2BNE0  161 LLLVAtprvnSGLDTDQPSMRDPTKSPALH---AIW---QIMQYYKVDSKYHAPALIVSTGAVWWIPPpgkRNVVSVQYL 234  American grass carp...
Q8JU61  161 LLVQArprvpSGLVTDQPTRRDPTQSPALH---AIW---QVMQYYKVAGVYYAPALVVPSGAIWWIPPpgkRNVVSVQYL 234  Golden shiner reovirus
2CSE_1  158 LLVSE-----AGGSLYDPVLQKYDEIPDLShncPLWcfrEICRHISGPLPDRAPYLYLSAGVFWLMSP---RMTSAIPPL 229 
5ZVS_2  235 LTDLISLAILAHMTDMSPTLELTGVLMYLRAASSHSYAYTLLQMKSVFPALSLRSMYRNKGfGGKAPAIEWTEPRSKYKF 314 
P0CK32  230 LSDLVNLAILQQTAGLDPSLVKLGVQICLHAAASSSYAWFILKTKSIFPQNTLHSMYESLE-GGYCPNLEWLEPRSDYKF 308  Mammalian orthoreov...
B2BNE0  235 LTDLVNLAIIARMTDMHPTLGLCAARVYIQAATTDSYTHTLLKLKGVFPALSIHSMYRQKGfGGKAPDIQWTEPRTKYQF 314  American grass carp...
Q8JU61  235 LTDLINLAILAHMTDMSPTLELTGVLMYLRAASSHSHAYTLLQMKSVFPALSLRSMYRNKGfGGKAPAIEWTEPRSKYKF 314  Golden shiner reovirus
2CSE_1  230 LSDLVNLAILQQTAGLDPSLVKLGVQICLHAAASSSYAWFILKTKSIFPQNTLHSMYESLE-GGYCPNLEWLEPRSDYKF 308 
5ZVS_2  315 RWTGVTQLHDGLRPRSPSMDVPTLETLAKYELVDIGHTIIRERNAHPQHNHDSVRFVRDVMALTSGMYLVRQPTMSVLRE 394 
P0CK32  309 MYMGVMPLSTKYARSAPSNDKKARELGEKYGLSSVVSELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQE 388  Mammalian orthoreov...
B2BNE0  315 KWVGVTHLHDGLRPRAPVRDEAVRKLLTEYQLADIMAPIVEMRNQHKHHDHDSVRFVRDVMALTSGMYLVRQPTMSVLQE 394  American grass carp...
Q8JU61  315 RWTGVTQLHDGLRPRSPSMDVPTLEVLTKYELVDIGHIIIRERNAHPRHNHDSVRFVRDVMALTSGMYLVRQPTMSVLRE 394  Golden shiner reovirus
2CSE_1  309 MYMGVMPLSTKYARSAPSNDKKARELGEKYGLSSVVSELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQE 388 
5ZVS_2  395 YSQVPDIKDPIPPSAWTGPIGNVRYLLPSVQGPARHLYDTW-RAAARQIAQDPQWhDPLNQAIMRAQYVTARGGSSASLK 473 
P0CK32  389 YTQSPEIKVPIPQKDWTGPVGEIRILKDTTSSIARYLYRTWyLAAARMAAQPRTW-DPLFQAIMRSQYVTARGGSGAALR 467  Mammalian orthoreov...
B2BNE0  395 YSQVPDIKQPIPPSAWTGTVGNVRYLNKDVTGPARWLYNTW-REAAQEIAQDRTWhDPVNQFIMGSQYVTARGGSGSSLK 473  American grass carp...
Q8JU61  395 YSQVPDIKDPIPPSAWTGPIGNVRYLLPSVQGPARHLYDTW-RAAARQIAQDPQWhDPLNQAIMRAQYVTARGGSSASLK 473  Golden shiner reovirus
2CSE_1  389 YTQSPEIKVPIPQKDWTGPVGEIRILKDTTSSIARYLYRTWyLAAARMAAQPRTW-DPLFQAIMRSQYVTARGGSGAALR 467 
5ZVS_2  474 FALKVTGIVLPEYDDSKVKKSSKIYQAAQIARIAFMLLIAAIHAEVTMGIRNQVQRRARSIMPLNVIQQAISAPHTLVAN 553 
P0CK32  468 ESLYAINVSLPDFKGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTAD 547  Mammalian orthoreov...
B2BNE0  474 HSLTVTGLVLPEFSESSVKRSSKIYQAAQIARIPFTLLTAAIHAEVVMAIRNQVQRRARSIMPLNVVQQAVSAPHTLVAN 553  American grass carp...
Q8JU61  474 FALKVTGIVLPEYDDSKVKKSSKIYQAAQIARIAFMLLIAAIHAEVTMGIRNQVQRRARSIMPLNVIQQAISAPHTLVAN 553  Golden shiner reovirus
2CSE_1  468 ESLYAINVSLPDFKGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTAD 547 
5ZVS_2  554 YINKHMNLSTTSGSVVTDKVIPLILYASTPPNTVVNVDIKACDASITYNYFLSVICGAMHEGFEVGNADAAFMGVPSTIV 633 
P0CK32  548 YINYHMNLSTTSGSAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASGSIGKPFMGVPASIV 627  Mammalian orthoreov...
B2BNE0  554 YINKHMNMSTTSGSVVTDKVVPLLLYASTPPRTVVNVDIKACDASITYDYFLSLICGAMHEGFEVGDNHASFMGVPSSII 633  American grass carp...
Q8JU61  554 YINKHMNLSTTSGSVVTDKVIPLILYASTPPNTVVNVDIKACDASITYNYFLSVICGAMHEGFEVGNADAAFMGVPSTIV 633  Golden shiner reovirus
2CSE_1  548 YINYHMNLSTTSGSAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASGSIGKPFMGVPASIV 627 
5ZVS_2  634 SDRRSPVAPYSRPISGLQTMVQHLADLYAAGFRYSVSDAFSSGNKFSFPTSTFPSGSTATSTEHTANNSTMMEYFLNVHA 713 
P0CK32  628 NDESVVGVRAARPISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWG 707  Mammalian orthoreov...
B2BNE0  634 MDKRSALAPYSRTVSGLQTMVQHLSQMYANGFRYSVTDAFSSGNKFSFPTSTFPSGSTATSTEHTANNSTMMSYFLAVHA 713  American grass carp...
Q8JU61  634 SDRRSSVAPYSRPISGLQTMVQHLADLYAAGFRYSVSDAFSSGNKFSFPTSTFPSGSTATSTEHTANNSTMMEYFLNVHA 713  Golden shiner reovirus
2CSE_1  628 NDESVVGVRAARPISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWG 707 
5ZVS_2  714 PSHVKSASLKRILTDMTIQRNYVCQGDDGILLLPHEAASKISADDMNELLTCLRDYGQLFGWNYDIDWSDTAEYLKLYAL 793 
P0CK32  708 PEHTDDPDVLRLMKSLTIQRNYVCQGDDGLMIIDGNTAGKVNSETIQKMLELISKYGEEFGWKYDIAYDGTAEYLKLYFI 787  Mammalian orthoreov...
B2BNE0  714 PQHIKSPNMKRVLSDMTIQRNYVCQGDDGVLLLPDEAASKISAEDMDELLTCLKDYGTSFGWVYDIDWSDSAEYLKLFAL 793  American grass carp...
Q8JU61  714 PSHVKSASLKRILTDMTIQRNYVCQGDDGILLLPHEAASKISADDMNELLTCLRDYGQLFGWNYDIDWSDTAEYLKLYAL 793  Golden shiner reovirus
2CSE_1  708 PEHTDDPDVLRLMKSLTIQRNYVCQGDDGLMIIDGNTAGKVNSETIQKMLELISKYGEEFGWKYDIAYDGTAEYLKLYFI 787 
5ZVS_2  794 MGCRIPNTSRHPPVGKEYAAPQTDEIWPSLIDIVIGHHLNGVTDVLNWREWLRFSWAFACYSSRG--------GYtnprg 865 
P0CK32  788 FGCRIPNLSRHPIVGKERANSSAEEPWPAILDQIMGIFFNGVHDGLQWQRWIRYSWALCCAFSRQrtmigesvGY----- 862  Mammalian orthoreov...
B2BNE0  794 CGCRVPNVSRHPPVGKEYASPTTDEIWPSLIDIVVGHHLNGVMDLMNWREWLRFSWAFACYASRG--------AYtdkyg 865  American grass carp...
Q8JU61  794 MGCRIPNTSRHPPVGKEYAAPQTDEIWPSLIDIVIGHHLNGVTDVLNWREWLRFSWAFACYSSRG--------GYtnpkg 865  Golden shiner reovirus
2CSE_1  788 FGCRIPNLSRHPIVGKERANSSAEEPWPAILDQIMGIFFNGVHDGLQWQRWIRYSWALCCAFSRQ---------Rtmige 858 
5ZVS_2  866 qsfsAQYPWWTFVYLGIPPILLPGQTPFIHSCYMPPGDQGMFSILNGWR----DWLISHASTTlpplRHNHPVWGLSDVP 941 
P0CK32  863 ----LQYPMWSFVYWGLPLVKVFGSDPWIFSWYMPTGDLGMYSWISLIRplmtRWMVANGYAT----DRCSPVFGNADYR 934  Mammalian orthoreov...
B2BNE0  866 ethiAQYPWWTFVYLGIPPILLPGQTPFIHSLFMPPGDQAMFAILNNWR----DLISTNTTTTfpplKHPHHTWHLADVP 941  American grass carp...
Q8JU61  866 qsfsAQYPWWTFVYLGIPPILLPGQTPFIHSCYMPPGDQGMFSILNGWR----DWLISHASTTlpplRHNHPVWGLSDVP 941  Golden shiner reovirus
2CSE_1  859 svgyLQYPMWSFVYWGLPLVKVFGSDPWIFSWYMPTGDLGMYSWISLIRplmtRWMVANGYAT----DRCSPVFGNADYR 934 
5ZVS_2  942 SLLSQFGVYAGYHAAQHYRRPKPAPETASSDSINQITSDLTEYLFYDSALKARVMKGRYNWERLSSSLSLNvgsrVPSLF 1021
P0CK32  935 RCFNEIKLYQGYYMAQLPRNPTKSGRAAPREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHN----PPSLF 1010 Mammalian orthoreov...
B2BNE0  942 TLLDSYGVYAGYHAAQHPRRPVAQPETANSESIEQITGALTDYLLYDPILKARVNTGRHNWSQLSQSIGLNiggrVPSLM 1021 American grass carp...
Q8JU61  942 SLLSQFGVYAGYHAAQHYRRPKPAPETASSDSINQITSDLTEYLFYDSALKARVMKGRYNWERLSSSLSLNvgsrVPSLF 1021 Golden shiner reovirus
2CSE_1  935 RCFNEIKLYQGYYMAQLPRNPTKSGRAAPREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHN----PPSLF 1010
5ZVS_2 1022 DVPGKWVAAGRDAEKPPPSSVEDMFTSLNRCIRRPTHSFSRLLELYLRVHVALGESIPLAIDPDVPQVAGADPANDDHWF 1101
P0CK32 1011 DVPHKWYLGAQEAATATREELAEMDETLMRARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFL 1090 Mammalian orthoreov...
B2BNE0 1022 DVPGKWVAAGREAEKPPPSAIVYMFKSLNRTIRRPSKHFSKLLELYIRVKVVLGAPKPLAIDPDIPQVAGADPHNDDPWF 1101 American grass carp...
Q8JU61 1022 DVPGKWVAAGRDAEKPPPSSVEDMFTSLNRCIRRPTHSFSRLLELYLRVHVTLGESIPLAIDPDVPQVAGADPANDDHWF 1101 Golden shiner reovirus
2CSE_1 1011 DVPHKWYLGAQEAATATREELAEMDETLMRARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFL 1090
5ZVS_2 1102 KYTCLGDIPSATRNYFGESLFVGRVVSGLDVEAVDATLLRLKILGAPPEAFIAVLNGIGMSDSEAHQIAGRISLANAQLV 1181
P0CK32 1091 KMVSVGPMLQSTRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVSTV 1170 Mammalian orthoreov...
B2BNE0 1102 KYVGLGDIPTSTRRYFGESLFVGRVVSGLDVEAVDAALLRLKILGAPPAAYIALLNGIGMSNSEANQIAGRVSLANAQTV 1181 American grass carp...
Q8JU61 1102 KYTCLGDIPSATRNYFGESLFVGRVVSGLDVEAVDATLLRLKILGAPPEAFIAVLNGIGMSDSEAHQIAGRISLANAQLV 1181 Golden shiner reovirus
2CSE_1 1091 KMVSVGPMLQSTRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVSTV 1170
5ZVS_2 1182 QIARVVHLSIPSSWMTLNTGPYIHHHA-----------YDFKPGITqpsaksrdksiWMSPILKLLCTSYAMTVAGPVRT 1250
P0CK32 1171 QLARVVNLAVPDTWMSLDFDSMFKHHVkllpkdgrhlnTDIPPRMG-----------WLRAILRFLGAGMVMTATGVAVD 1239 Mammalian orthoreov...
B2BNE0 1182 QIGRVVNLSTPSSWMTLDTAPYIQYHT-----------YDFKPGVTnpsaqsrekfiWLSPILKLLCATAAMSIAGPVRE 1250 American grass carp...
Q8JU61 1182 QIARVVHLSIPSSWMTLNTGPYIHHHA-----------YDFKPGITqpsaksrdksiWMSPILKLLCTSYAMTVAGPVRT 1250 Golden shiner reovirus
2CSE_1 1171 QLARVVNLAVPDTWMSLDFDSMFKHHVkllpkdgrhlnTDIPPRMG-----------WLRAILRFLGAGMVMTATGVAVD 1239
5ZVS_2 1251 SIVTEIDGSAAALSGNLRVWMRDV 1274
P0CK32 1240 IYLEDIHGGGRALGQRFMTWMRQE 1263 Mammalian orthoreovirus 1 Lang
B2BNE0 1251 AYVLDIHGSAASLSGNFREWMR-A 1273 American grass carp reovirus PB01-155
Q8JU61 1251 SIVTEIDGSAAALSGNLRVWMRDV 1274 Golden shiner reovirus
2CSE_1 1240 IYLEDIHGGGRALGQRFMTWMRQE 1263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap