2C0G


Conserved Protein Domain Family
ERp29_N

?
pfam07912: ERp29_N 
Click on image for an interactive view with Cn3D
ERp29, N-terminal domain
ERp29 is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle. The protein exists as a homodimer, with each monomer being composed of two domains. The N-terminal domain featured in this family is organized into a thioredoxin-like fold that resembles the a domain of human protein disulphide isomerase (PDI). However, this domain lacks the C-X-X-C motif required for the redox function of PDI; it is therefore thought that ERp29's function is similar to the chaperone function of PDI. The N-terminal domain is exclusively responsible for the homodimerization of the protein, without covalent linkages or additional contacts with other domains.
Statistics
?
PSSM-Id: 400320
View PSSM: pfam07912
Aligned: 3 rows
Threshold Bit Score: 201.617
Threshold Setting Gi: 14285434
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2C0G_B  13 VTCTGCVDLDELSFEKTVERFPYSVVKFDIASPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVD 92  fruit fly
Q7QFB5  21 WTARGCVDLDSSTFDLVTRKFRYSLVKFDTAFPYGDKHEAFTGLALETVGTTDELLFALVGIKDYGEQDNADLGRRFAIP 100 Anopheles gambiae str...
P57759  35 LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLA-ENSASSEELLVAEVGISDYGDKLNMELSEKYKLD 113 house mouse
2C0G_B  93 DKnFPSIFLFK-GNADEYVQL-PSHVDVTLDNLKAFVSANTPLYIGRD 138 fruit fly
Q7QFB5 101 KE-YPVIKLFH-GDGTPPIDFaPADGEVTGDSLRKFLKRHTALYIGLP 146 Anopheles gambiae str. PEST
P57759 114 KEsYPVFYLFRdGDLENPVLY---NGAVKVGAIQRWLKGQ-GVYLGMP 157 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap