Conserved Protein Domain Family
DUF1669

?
pfam07894: DUF1669 
Protein of unknown function (DUF1669)
This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this.
Statistics
?
PSSM-Id: 400309
View PSSM: pfam07894
Aligned: 60 rows
Threshold Bit Score: 309.848
Threshold Setting Gi: 47224030
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007498018  15 NWRSSESKPEFFYSEEQRLALEALVARGPEAFYEVLKKENIRDFLSELELKKILET-I-------EVY------------ 74  gray short-tail...
XP_003228186  19 NLSFRLAKLDFSHNESVRLATDALLDGGHPAYLKALEDEGEVDFLSTVEAQYIKRN-AkepyyssD-------------- 83  green anole
XP_003760413  19 NQWSRLPKVDFSHNESARLALDALLDGGPESYQKALSKEGEVDFLSSVEAQYIQEN-AkqpfyakEQA------------ 85  Tasmanian devil
XP_012362081  19 SQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQYIQAQ-AreppcppDTL------------ 85  northern white-...
XP_016082609  19 TRWTRPTRMDFSHNESIRLATDALVNGGLESYQETLGEEGEVDFLSSAEACYIQEN-TsqpngapQSP------------ 85  platypus
XP_031408775  50 NQSLKSTKADFSHNESIRLATDAFLDGGTDSYLQTLSKEGEVDFLSSVEARYIKEN-AresyyaqESP------------ 116 turkey
NP_001008047  19 NKWARLSKADYSYNESARLATDALLDGGVEDYQKVLSEEGEVDLLSGDELQYILKN-IkaplysnDNQ------------ 85  tropical clawed...
XP_006636141  28 yqSSQLSRIDLSHNESVRLATDALLDSGLQAYEETLTAEGEVDFLSQAEKEYILRS-AkerspadESQ------------ 94  spotted gar
CAG12859      22 DFPAGGHRLDLSHNESARMAVDSLLSRGLKEYHQVLRAEGEVDFLSQPEKMYIMEN-GragsagsSRTllkgclertrns 100 spotted green p...
XP_003211964  74 PWWREPTPLVLQHSETARLAVDAFLEQGERGYMSAVAEERELPFLSTLDMEYMSQQrSqsfpeanAKR------------ 141 turkey
XP_007498018  75 --------------DPGSENlRDPRGPHEGPEphdkeengqgdadadlvpSLEYWPQKS-DRSIPQLDLGWP-DT--IAY 136 gray short-tail...
XP_003228186  84 ----------------GEVG-PRQNNDARSLQ------------------SGTYFPLVS-ENSEPALLHTWStSEk-PYL 126 green anole
XP_003760413  86 --------------GEGELG-LQV-NDSGSLQ------------------SGTYFPVLS-EGSEPALLQSWGeAEk-PYL 129 Tasmanian devil
XP_012362081  86 --------------GGAEAG-PKG-LDSSSLQ------------------SGTYFPMAS-EGSEPALLHSWAsAEk-PYL 129 northern white-...
XP_016082609  86 --------------GGEWLD-LQE-SDVDSLQ------------------SGTYFPQFS-GGGEPDL----GdAGk-PYL 125 platypus
XP_031408775 117 --------------TDGAAA-QRQ-NDGGSLP------------------SGTYFPTIS-DSSEPALLHTWItAEk-PYL 160 turkey
NP_001008047  86 --------------TEGENG-----SAANGNK------------------SESYYPMNS-DSEPVPTLHNWSaEEk-PYL 126 tropical clawed...
XP_006636141  95 --------------AEEGEN-LGETAAPTET-------------------SVTYFPTLS-ESEAPALDYGWPmAEsrYYL 139 spotted gar
CAG12859     101 leiqpflflvfnaaGSSTSG-DQVESSLPDSQ------------------GDTLCPAPStDSDPPASEDQSCqRDvsSCV 161 spotted green p...
XP_003211964 142 --------------DKEGDPadgdgss-----------------lcseltSGTYFPLMS-DVHPPELELGWPgMPi-LTV 188 turkey
XP_007498018 137 RGVTRASVYMQPPiDGQAHIKEVVRKMIHQAQKVIAVVMDMFTDVDIFKDLLDAGFKRKVAVYVIVDEANVKYFLHMCER 216 gray short-tail...
XP_003228186 127 KEKSSATVYFQTD--KNSNIRDLIRRCINKTSQVLAILMDVFTDAEIFCDILEAANKRQVFVYLLLDHSNLKLFTEMCDK 204 green anole
XP_003760413 130 KEKSSATVYFQTD--KHNNIRDLIRRCISKTSQVLVILMDVFTDAEIFCDVLEAANKRGVFVCVLLDQCGINLFREMCDK 207 Tasmanian devil
XP_012362081 130 KEKSSATVYFQTD--KHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDK 207 northern white-...
XP_016082609 126 KEKSSVTVYFQTD--RHSSIRDLIRRCIGKTNQVLAILMDEFTDIEIFCDVLEAANKRGVFVYILLDQRGVKLFNEMCNR 203 platypus
XP_031408775 161 KEKSTATVYFQTE--KNSNIRDIIRRYINKTTQVLAIVMDVFTDTEILCDLLEAANKRMVFVYLLLDHGNINLFSEMCDK 238 turkey
NP_001008047 127 KDKSSATVYFQAD--KTNNVRETIRRCINKTTQALAILMDEFTDAEIFCDVLEAANKRNIFVYLLLDANKLHLFIQMCEK 204 tropical clawed...
XP_006636141 140 QGKPSVEVYFQTD--RSRSIKDLVREYISKATTVLAIVMDIFSDVEVFCDILEATKKRNVSVYLLLDHMNLHVFTEMCEK 217 spotted gar
CAG12859     162 PVKPSLEVFFQSH-GGAASMKDLIREFMRKATETLAIVMDSFSDVELLCDLLEASRKRNVSVYLLLDHLNLSLFLHMWQE 240 spotted green p...
XP_003211964 189 SGQTQATIIFQRN--KVNSIKDLLRSLISQAQTVIAIVMDLFTDMEILCDLLEASSRRHVPVYLILDEEYLKHFVEMCNK 266 turkey
XP_007498018 217 AQMHTGHMKNLRVRSIGGTEFFTRSATKFKGALAQKFMFVDGDRAMCGSYSFTWSAARTDRNVISVLSGQVVEMFDKQFQ 296 gray short-tail...
XP_003228186 205 LHVAEGYFKNISVRSVTGEVYCAKSGRKFSGQIQEKFIISDWRYVLSGSYSFTWLCGQVHRNFLSKFTGQVVELFDEEFR 284 green anole
XP_003760413 208 AEILDSHLKNISVRSVEGETYCAKSGKKFSGQIQEKFIISDWRYVLTGSYSFSWLCGQVHRNFLSKFTGQAVELFEEEFR 287 Tasmanian devil
XP_012362081 208 VQISDSHLKNISIRSVEGEVYCAKSGRKFAGQIREKFIISDWRFVLTGSYSFTWLCGHVHRNILSKFTGQAVELFDEEFR 287 northern white-...
XP_016082609 204 AQILEIHLKNICIRSVAGEVYCAKSGRKFSGRIQEKFIISDWRCVLSGSYr----------------------------- 254 platypus
XP_031408775 239 LQIAEDLFKNISVRSVTGEVYCAKSGRKFSGQIQEKFLISDWRYVLSGSYSFTWLCGQVHRNLLSKFTGQVVELFDEEFR 318 turkey
NP_001008047 205 LQVRDLHMTNISVRSVTGDVYCAKSGKKFAGQINEKFIISDWRFVLSGTYSFTWLSGQVHRNFLYKFSGDVVELFDEEFR 284 tropical clawed...
XP_006636141 218 LQINSSYLTRMSVRSVTGDVYCTKSGRKFSGQIKEKFVIFDCIHALAGSYSFTWLSAQVDKNMAVLFKGSSVKHFDLEFR 297 spotted gar
CAG12859     241 LQLNSKNFPKLCVRSVQGQTYCARTGRKLTGQIRESFIITDWTEVLTGSFSFSWLSWQVHRSLAVLLKGSAVPPFNTEFL 320 spotted green p...
XP_003211964 267 MSLTKDSFPNMCIRCLSGDTYYSKAGKKFVGQVLEKFVLIDCDQVVAGTYSFTWLCSQVHTSLATHFRGQIVAEFDKEFR 346 turkey
XP_007498018 297 ELYLMSQG 304 gray short-tailed opossum
XP_003228186 285 HLYASSKP 292 green anole
XP_003760413 288 HLYSSSKP 295 Tasmanian devil
XP_012362081 288 HLYASSKP 295 northern white-cheeked gibbon
XP_016082609     --------     platypus
XP_031408775 319 HLYALSKP 326 turkey
NP_001008047 285 NLYASSKP 292 tropical clawed frog
XP_006636141 298 QLYAVSKP 305 spotted gar
CAG12859     321 RLNSSSQT 328 spotted green pufferfish
XP_003211964 347 YLYAESKA 354 turkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap