Conserved Protein Domain Family
DUF1664

?
pfam07889: DUF1664 
Protein of unknown function (DUF1664)
The members of this family are hypothetical plant proteins of unknown function. The region featured in this family is approximately 100 amino acids long.
Statistics
?
PSSM-Id: 400305
View PSSM: pfam07889
Aligned: 32 rows
Threshold Bit Score: 112.319
Threshold Setting Gi: 302851839
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9C5M5               93 LQALAVPAAALGALGYGYMWWKGLSFTDLMYVTKANMAAAVANLTKNLEQVSETLAAAKRHLTQRIQNLDDKVEKQIDLS 172  thale c...
XP_005843166         86 yilyGSAAAGLGVVLYFRVL-RGWTFGDMLYATRRGLRDGLNQVSAGLEQLGAKVQEVKARLQERIAHVVRKQEEMLAVQ 164  Chlorel...
XP_002957442         94 WSVYILPAAVVGGVVYLYVRIRGVSISDFFMVTNKSLQSFRELVSQSMTQLWEELRKQKDEFIKRIATVGEQQQAMMAQQ 173  Volvox ...
ACN25694             93 GAYGITAVVIGGAIGYLFIRWKGWKLSDMMFVTKRGLSDACNVVGKQVDQVSESVNVAKKHLAGRIDRVDCSLDECQEIT 172  Zea mays
Q655L6               93 GAYGITAVV-AGAIGYLYIRWKGWKLSDLMFVTKRGLSDACDVVGKQLEHVSENVNAAKRHLAGRIDHVDCTLDECQEIT 171  Japanes...
WGS:AAAA:OsI_18100   92 GTFTITAVVVAGAVGYAYIKWKGWKLSDLMFVTKRGLSDACNVVGSQLDKVSDDVTSARKHLAGRIDRVDISLDETQEII 171  long-gr...
KQK08136             90 GALTITAVVAAGVIGYAYIRWKGWKVSDFMWVTKRGLSDACNVVGNQLTEVSDSVHVAKKHLSGRIDRVDASLDEAQEII 169  stiff b...
XP_002893459         93 KKYGL--IIIVGVIGYGYVWWKGWKLPDFMFATRRSLSDACDDVGKQIDGFYSSLSGTKQELGSQVDRVGRRLDANTEVI 170  Arabido...
Q8GYC5               93 KKYGY--IIIIGVIGYGYVWWKGWKLPDLMFATRRSLSDACNSVGSQIDGFYTSLSGTKKELSSKIDGMGRSLDANTEII 170  thale c...
Q8VYQ4               93 RNYGL--IIIVGVIGYGYVWWKGWKLPDFMFATRRSLSDACNNVGNQIDGFYSSLKGTKRELSSEIDMMGRRLDANTEVI 170  thale c...
Q9C5M5              173 KEINSQVISARENISSLEMDLESLHNLITGLDGKLDTLEYKQ 214  thale cress
XP_005843166        165 AEMQAALTGVGRDVEHTRGQVGQIHAVVMDLEASMAEVGVNQ 206  Chlorella variabilis
XP_002957442        174 TQMDEKLLTVSEKVEEIRGISDSIDTRVCQMDNSIKHMStgv 215  Volvox carteri f. nagariensis
ACN25694            173 EATKEEVTIIHGDLSAFQKEMETVHLVVRSLETKLGRLAYTQ 214  Zea mays
Q655L6              172 ESTRKEVTVIHEDISAFQEEMQSVHLVVRTLETKLGRLSYTQ 213  Japanese rice
WGS:AAAA:OsI_18100  172 EGTRDEVTVIHGDLSAFQEDLQSVNLVVRSLESKLVSLEYTQ 213  long-grained rice
KQK08136            170 EGTRDEVAIIHEDLSTFQRELQEVNHTVQIWGSRLSSIEDTQ 211  stiff brome
XP_002893459        171 EQTGREVTELQDGTAIIKDDVKSVFAAVETLANKVYRIEGNQ 212  Arabidopsis lyrata subsp. lyrata
Q8GYC5              171 QDTGREVMELQRGTENIKDDVKFVFDAVENLASKVYRIEGNQ 212  thale cress
Q8VYQ4              171 QETIQEVAKLQDGTSFIKDDVKAVFDAFENLASKVCRIEGNQ 212  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap