Conserved Protein Domain Family
CALCOCO1

?
pfam07888: CALCOCO1 
Calcium binding and coiled-coil domain (CALCOCO1) like
Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein coexpressed by Mus musculus (CoCoA/CALCOCO1). This protein binds to a highly conserved N-terminal domain of p160 coactivators, such as GRIP1, and thus enhances transcriptional activation by a number of nuclear receptors. CALCOCO1 has a central coiled-coil region with three leucine zipper motifs, which is required for its interaction with GRIP1 and may regulate the autonomous transcriptional activation activity of the C-terminal region.
Statistics
?
PSSM-Id: 400304
View PSSM: pfam07888
Aligned: 10 rows
Threshold Bit Score: 435.093
Threshold Setting Gi: 1040657738
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A2BGD5       114 KPLEELVTLEEEGQG--EEVGEDMLLVIPRAQLLQS--------RLQECLKERAELLQALEAADQNVEREKGRRERDRGS 183 zebrafish
1_pfamImport   1 KPLEDLVTLEEEPHG--EEGSTGMLLVVPRAELLQG--------RLQECLRERAELLQAQEVANRRREKDQEEHKRAREA 70 
XP_017213695 114 RPLDELVTLEKTGEG--EEDGDDLLLVVPKALILQN--------LLEGCQRELHELHKKFEAVNGDVENERQRWKTDRDE 183 zebrafish
XP_008101852 118 RPMDELVTLEEASD---DGAGTDMLLVVPKATLLET--------QLEESRQQQGVLLQE------------------SCR 168 green anole
Q9P1Z2       122 RPMDELVTLEE------ADGGSDILLVVPKATVLQN--------QLDESQQERNDLMQL------------------KLQ 169 human
XP_005813248 114 KPLEDLVTLEDESHG--EDGGTGMLLVIPRAELLQS--------RLQECLQERTELLREQEAAKKQRERDREDYKREKQQ 183 southern platyfish
XP_005478100 114 KPLEDLVTLEEDSHG--EEAGTDMLLVVPRAELLQN--------RLQECLRERAELLQVQEAVKEQREKEKEEYKRAREA 183 Nile tilapia
CAG07391     112 KPLEDLVTLEE-SHG--EEEGTDMLLVVPRAELLQVsrtqnrliRLQECLQERAELLQAHEAANRQREKEKMEYRGAREA 188 spotted green p...
XP_012407287 122 RPMDELVMLEE------SENGSDILLVVPKATVLQN--------QLEESQQERNDLMRL------------------KLQ 169 Tasmanian devil
XP_015199580 118 KPLDELVTLEERREGeeEEEGEGMLLVIPRAELLQA--------RLEECLRERAELLQAREASQRGREED-------REE 182 spotted gar
A2BGD5       184 WEHTRKELERKIDDLKEEVREYRE--------KVEDMKkkqkEVEDLGEALTE--------------------------- 228 zebrafish
1_pfamImport  71 WDRRHRALERDVARLQEELKQSRE--------KVEGME----EVQAFGESLAQ--------------------------- 111
XP_017213695 184 FEILRSDMRSQIEELKTNLRHSTE--------KTEELEqkhkEAQISSESMSA--------------------------- 228 zebrafish
XP_008101852 169 LKDEVKELRSHMAELEAALGSLRD--------DHTKLAaqykELSDSSAEVSK--------------------------- 213 green anole
Q9P1Z2       170 LEGQVTELRSRVQELERALATARQ--------EHTELMeqykGISRSHGEITE--------------------------- 214 human
XP_005813248 184 WDRQRRGLEREVSRLKEELAQSDQ--------KIEEMEmkqkDETALRDCLAQ--------------------------- 228 southern platyfish
XP_005478100 184 WDRRRKELEGDIARLQKElkqtlekl--------delekkqkEEKALGESLAQ--------------------------- 228 Nile tilapia
CAG07391     189 WDRRHRELE------------------------------------------SEisrlqrelnrsfrqtqdmqrkqeeeqd 226 spotted green p...
XP_012407287 170 LEGEVAELKSRVQELETVLQVTKE--------EQTKLMekykGLARAHGELKE--------------------------- 214 Tasmanian devil
XP_015199580 183 WDRQRRELSERLGRAREEASRLREtrqreaelD----------------------------------------------- 215 spotted gar
A2BGD5       229 -------EKRALLAQKEANEQRIRELEEDIKILTQRGLERETDLERMRERAK-------KSAAQKREDEDEHKNLKLKME 294 zebrafish
1_pfamImport 112 -------EKSALLDASEASKVRIKELEEDIKTLAQRSVEKETELERMKERAK-------RAGAQRKEEEGDRKSLQSKLE 177
XP_017213695 229 -------EFNALLAERAENQQRIKELEQDSATLTQQKQDIEAELERMKERVK-------KMTIQRRDEETERRDLQ---- 290 zebrafish
XP_008101852 214 -------QKDTLSLQEAEHLARIRELEGDIQAMGEKMLLRETELDRVKDTVKsllreqeQIHNQLKEEYAEKEQYQVKLQ 286 green anole
Q9P1Z2       215 -------ERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKaltreqeKLLGQLKEVQADKEQSEAELQ 287 human
XP_005813248 229 -------EKAALMEVKAAKEQLIRELEEDIKTLTQRAVERETELERMKDRAK-------RAIALRKEEETENKGLQNKLD 294 southern platyfish
XP_005478100 229 -------EKIALMDAREASEARIRELEDDIKSLAQRAVEKETELERIKERAR-------RAGALRKDEESERRSLQTKLE 294 Nile tilapia
CAG07391     227 lvellaqEKSTLLEANEESRVRIRELEEDVRTLTQRTVDRETEMERMKERAK-------RAGAQRKEEESERSALQSKLE 299 spotted green p...
XP_012407287 215 -------ERDVLSKQQGDHVARILELEDDIHAISEKVLEKEVELDRVKDTVKaltqeqeKLLGQLKEEQADKEQSQADLQ 287 Tasmanian devil
XP_015199580 216 ---------------------RLKE-----------------RLRRLTQQQE-------QAVRQKGEEEEERKALQGKLL 250 spotted gar
A2BGD5       295 QTEKELHSLSAEFQSLRSSLAQRDTHALQLRDTITTLTHKLNSAHRKEAANELALNELRSVQERLNVSEHCVETLRGELR 374 zebrafish
1_pfamImport 178 QTEGELRSLSKEFQVLRNSLAQRDTSVLQLQNSITTLTQKLTAAHRKEAQNEATLKEMRSLRERLNLSERAAEALKSDLS 257
XP_017213695 291 ------------------------------------------------LENEQMHADLRTLQERLEASERSTEALRRDLS 322 zebrafish
XP_008101852 287 ASVEESRSLASDLQEAKNLHGEKISQTLVLQEDVNKLQQKLATANRRTAQMEALCEQLRSTQDVLAASQQKVALLGEELA 366 green anole
Q9P1Z2       288 VAQQENHHLNLDLKEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKATLLGEELA 367 human
XP_005813248 295 QTEAELRSLSKEFQVLRNSLAQRDTSVLQLQNTITTLTQKLTTAHRKETESEASLKEMRSLRERFHISERTVEGLKSDLS 374 southern platyfish
XP_005478100 295 QTESELKSLSKEFQGLRNSLAQRDTSVLQLQNTITTLTQKLTTAHRKEAENEASLKEMRSLRERLHMSERAAEGLKSDLS 374 Nile tilapia
CAG07391     300 QTEAELRSLSKEFQGLRNSLAQRDTSVLQLQSTITTLTQKLTAAHRKEAEHEATLKEMRSLRERLNTSERTSEGLKSNLS 379 spotted green p...
XP_012407287 288 ASQVECCRLSTDLQKAKSHQDQQASELQRLQEEVTRTQNLLDEAQQHIAELEPLKEQLRGSQELAVSSQQKAALLGEELA 367 Tasmanian devil
XP_015199580 251 SSEEELRRMCSEFQSLRGSLAERETQALTLRDTISTLTLRLNTAQQREVENESLRQELSSLRERLCASERRVEGLGAELE 330 spotted gar
A2BGD5       375 DMVAQRDSAHAELHQARLQAAQLTLQLADASLALREGRANWAQERETLQQNAEIDKVRLERQNDEIQQKEEMLQKARMER 454 zebrafish
1_pfamImport 258 AMVAQRDHGQAEMHQARLQAAQLTLQLADSSLAMREGRARWAQERQNLQRTAEKDHERLEKLSTEMQRTEERLQEERMER 337
XP_017213695 323 ELGSLQSHSHAELHQVRLQSAQMSLQLSQANLALREGQSTWAQERETLRQSAELDKDRVQKLSRELQKKEEWLQEERSER 402 zebrafish
XP_008101852 367 SVASIRDRTISDLHKSRLEAAETNIKLADMTLKWKEGKGQWWKEKTTLLQNMEAEKDKILKLSAEVLRLEKSLQEERSQR 446 green anole
Q9P1Z2       368 SAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQN 447 human
XP_005813248 375 SLAAQKDHVQAELHQARVQAAQLTIQLADASMALREGRANWAQDRQSLQNAAELDQEHSERLNAELQKMQERLQEETMER 454 southern platyfish
XP_005478100 375 SMVTQRDQGQAELHQARLQAAQLTLQLADSSLALREGRAHWAQERQNMQRSAEKDHERLEKLSQEMQAMEEMLQEERMER 454 Nile tilapia
CAG07391     380 SMVTQRDRTQSELHQARLQAAQLTLQLADASLALREGRARWAQERQSLQLSAEKDHERLQTLNAEIQKMEETLQEERMEK 459 spotted green p...
XP_012407287 368 STASARDRTMAELHRSRLELAEANNRLMELSLQWREDKGSWSKERTGLLQNVEAEKDKILKLSAEVLRLEKAVQEERTQR 447 Tasmanian devil
XP_015199580 331 VVGGQRDRGQTELHQARLEAAQLTLQLAETRLAMREGRARWQGEREALQQSAQMDRERIAELSEALQQAEARLQEERMER 410 spotted gar
A2BGD5       455 EKAVVELGREKDCNR-----------ELKASLRVAQKEKEQLQTEIQ------------------EVMEYSRQLERRLEV 505 zebrafish
1_pfamImport 338 VKLEVELGRERDCNRvqlsetcrelqELKASLRVAQKEKEQQLAEKQ------------------ELMEYICQLEQKMGT 399
XP_017213695 403 EKLEVELGIEKDCNR-----------EQRASLRALQKEQEQHQLEKQ------------------ELLDHIHVLELRLDT 453 zebrafish
XP_008101852 447 QVLRVELAQERDSSLvqvsesrrelrELRAALQVAQKEKEQLQAEKQ------------------ELLIYIRRLEERLEK 508 green anole
Q9P1Z2       448 QVFKTELAREKDSSLvqlseskreltELRSALRVLQKEKEQLQEEKQ------------------ELLEYMRKLEARLEK 509 human
XP_005813248 455 VKLEVELGREKDCNRvqlserrrelqELKASQKVAQKEKEQLRAEKR------------------ELMEYICQLEQKTGT 516 southern platyfish
XP_005478100 455 VKLEVELGREKDCNRvqlsetrrelqELKASLRVAQKEKEQLLAEKQ------------------ELMEYICQLEQKMGT 516 Nile tilapia
CAG07391     460 VKLEVEIGREKDCNRvqlcetrrelqELKASLRVTQKEKEQLLAEKQvrraaclhqspvltkedrELMQYICQLEQKTGM 539 spotted green p...
XP_012407287 448 QGLKADLAQEKDSSLvqlseskreltELRSALRVFQKEKEQLQEEKQ------------------ELLEYMRKLEARLEK 509 Tasmanian devil
XP_015199580 411 EKAEVELARDRDCNRvqrgeasrelqELKSSLRLGQREKEHLLHQQQ------------------ELLQYVRQLEQRLEA 472 spotted gar
A2BGD5       506 LSDCKWSETALLQSS---------------RAESPlLSDSEDENPEALQdthSSGPLNHYSLCEQP--QSDLLLPATPPP 568 zebrafish
1_pfamImport 400 AVGAKWSAAPIAYTGdrffss----vhpadLPASV-LSDSEDENPEALQplrPPRPLGHYSLCEQG--QPDSLLLATPPP 472
XP_017213695 454 ETDAKWAEAAATPICqfaksy----lhraaYIDS---LSSIDEKP-LLE---SSSELSLSALDSEQ-------HNESTEN 515 zebrafish
XP_008101852 509 VADDKWSESVLVDKEetaleapasemfirdALDSP-LSDSEDECPEDMR---LPAQIGSYSLCDNR-------AATTTPP 577 green anole
Q9P1Z2       510 VADEKWNEDATTEDEeaavg---------lscpAA-LTDSEDESPEDMR---LPP----YGLCERG-------DPGSSPA 565 human
XP_005813248 517 VTTARWDAAPIASTG---------------RPETA-LSDSEDESPEALQilhPPRSLGHYSLCEQG--QPDSLLLSTPAV 578 southern platyfish
XP_005478100 517 VASAKWSLAPVASTGr---------------PDSV-LSDSEDENPEALQilhPPRPLAHYSLCEQG--QPDSLLLATPPL 578 Nile tilapia
CAG07391     540 VSSAKWSTAPLLFPg---------------RPSSA-TSDSEDENPEALQplrPPRPLGNYTLGEQG--GPGSLDLTTPPP 601 spotted green p...
XP_012407287 510 VADEKWSEDAATEDEeatl----------gyttAV-LSDSEDEYPEDMR---LPA----HGLCERG-------GPGCNPS 564 Tasmanian devil
XP_015199580 473 VADAKWRDAASDSNS---------------RPDSP-VSESEEDSPEALQ---PPHPLGAYSLCDPPtfTTEALLLATPPP 533 spotted gar
A2BGD5       569 SPRHP--STVVISQPAPLSS-----PHQPSAR 593 zebrafish
1_pfamImport 473 SPREVerSTVVINQPAPLSS-----PRQADAD 499
XP_017213695 516 NPKDNedD--VMQEDLEVQPfssgiADQMLSE 545 zebrafish
XP_008101852 578 CARGPa-RTVVISQPAPIASqikqpPEDSSSD 608 green anole
Q9P1Z2       566 GPREAs-PLVVISQPAPISPhlsgpAEDSSSD 596 human
XP_005813248 579 AQRDTdrSAVVINQPAPLSL-----PHQANAD 605 southern platyfish
XP_005478100 579 SPREVsrREVVINQPAPLSL-----PHQATTD 605 Nile tilapia
CAG07391     602 SPREAerSTVVINQPAPLSS-----PRQASAD 628 spotted green pufferfish
XP_012407287 565 GPRDTp-AHVVISQPSPIAPhttrlHDDSSSD 595 Tasmanian devil
XP_015199580 534 SPQ----GGVVISQPAPLSS-----PRQQdse 556 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap