Conserved Protein Domain Family
RHH_5

?
pfam07878: RHH_5 
CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5
This family contains bacterial proteins that form a ribbon-helix-helix fold. This fold occurs in many examples of bacterial antitoxins.
Statistics
?
PSSM-Id: 400294
View PSSM: pfam07878
Aligned: 15 rows
Threshold Bit Score: 45.3561
Threshold Setting Gi: 122418672
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Osc7112_4810  14 SPRVAFYPPPEIKEKLEKLASIERRSISQMALLLVEEGLERAQ 56  Oscillatoria nigro-viridis PCC 7112
jgi:Aazo_5349      6 GKRVNVTFPVEVYERVAGLASDETRTVSQMIVVLCQEAMVARE 48  'Nostoc azollae' 0708
Q46HT9            14 SPRIQVVLPEDLCERLSELAERESRTVSNMAKVLIQEGVKYHE 56  Prochlorococcus marinus str. NATL2A
CAK27287          18 SPRIQVVLPEALLERLAVAADQDSRTVSNMAKVLIQQGLDRLQ 60  Synechococcus sp. RCC307
Q7VEB2            14 SPRVQVVLPEELCAQLTFLAKKESRTVSNMAKVLIQEGVDSLI 56  Prochlorococcus marinus
WP_009546310       9 GKRISITLSDEILEDLEIWAQQRGQTVAGLAALLVEKAVTEAQ 51  Crocosphaera subtropica
WP_013720519       7 SKRVAVTLPDDAREFLEQEAKETGVPLSNLMSYIAVKYVREEK 49  Methanothrix soehngenii
Q7NMR8            20 LDRVVAYVPTELKKELEQWAEAEERSVSWLVAKLIDRALQQRR 62  Gloeobacter violaceus
jgi:Osc7112_3869   7 rGRVTAYLPEEIQKALEEWAEEDSRSVSSLATYLLTKSVRERQ 49  Oscillatoria nigro-viridis PCC 7112
Q1QQP0            90 SVRINVTLPADVLEQIDRHAASEGFTRSGFLAHAAKKALAA-- 130 Nitrobacter hamburgensis X14
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap