Conserved Protein Domain Family
CtnDOT_TraJ

?
pfam07863: CtnDOT_TraJ 
homologs of TraJ from Bacteroides conjugative transposon
Members of this family have been implicated in as being involved in an unusual form of DNA transfer (conjugation) in Bacteroides. The family has been named CtnDOT_TraJ to avoid confusion with other conjugative transfer systems.
Statistics
?
PSSM-Id: 400286
View PSSM: pfam07863
Aligned: 10 rows
Threshold Bit Score: 61.5945
Threshold Setting Gi: 81417235
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MUM9                      272 FFLIGILGFFSVPTVSGWIIEAGGGiGNYGKNVNEQAKRAGGKALTGGKALSAAGGAVVGNALGRFR 338 Porphyromonas...
jgi:Solca_0210              306 FMVIGIIGYFTVPSIANYIVHAGGG-GGLTQKITSMLSSSSRTTIAAASTGAGMVADTMGNAASKIS 371 Solitalea can...
EHQ26171                    308 FLVIGIVGYFTVPNVANYIVHAGGG-NAMLQKVNTLVVGGTSTAASTAQTGAGMAADAMGNIYRRLK 373 Mucilaginibac...
WGS:ACWZ:HMPREF0669_01919.1 272 FFLIGIVGYFCVPTVAGWIIEAGGGiGSYGRNVNQTAQHGAQGAYTGGKAAMAGAGAAVGNVGGRIK 338 Prevotella sp...
Q7MUW4                       10 FLLIGIVGCYCVPTVAGWIIGAGGGiGSYERNVNQTAQRGTQGAYTGSKAMGGGAQVLLPVMSFDVS 76  Porphyromonas...
WP_008511017                302 FLVIGIVGYFSVPTVANYVVHAHGG-NGLMMRMSTIAAGGISTVTNTAVQGGAAAGERMGRGVGNMl 367 Mucilaginibac...
EHQ27526                    313 FLLIGIVGYFSVPTVANFIVHAHGG-NGMLQRVNNIATGTTSTVISTSAAVGSATGERMAQGAKnia 378 Mucilaginibac...
EHQ25488                    317 FLVIGIVGYFSVPNVANYVVHAGGG-NTILQRVNTIVSNTSSTASGAAIAGGGMTADALGDAYRNIK 382 Mucilaginibac...
WP_008504344                307 FLIIGIIGYFTVPSVANYIVNAGGG-NGLLQKVNSMVSSTTQSVMSAGASGSSMVADAFGNQRTNTs 372 Mucilaginibac...
EHQ24630                    280 FLLIGIVGYFTVPSTANYIVHAGGG-NTLVNKINSLVISSSRSATSAMS--GGMQADAYGNQRENVT 343 Mucilaginibac...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap