Conserved Protein Domain Family
Renin_r

?
pfam07850: Renin_r 
Renin receptor-like protein
The sequences featured in this family are similar to a region of the human renin receptor that bears a putative transmembrane spanning segment. The renin receptor is involved in intracellular signal transduction by the activation of the ERK1/ERK2 pathway, and it also serves to increase the efficiency of angiotensinogen cleavage by receptor-bound renin, therefore facilitating angiotensin II generation and action on a cell surface.
Statistics
?
PSSM-Id: 400278
View PSSM: pfam07850
Aligned: 30 rows
Threshold Bit Score: 108.159
Threshold Setting Gi: 309366921
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP20583     109 AYGGHAVVELLNFKAEDssedvtssemwysefenpknpefienhKIQKREVSGIPGVREPTVYeqlrdaarkSYGV---- 184 Caenorhabditis ...
XP_001607306 236 AYKNQVLIAVFTNDASQ---------------------------VRHTRSLHERFERQAVMDSakn----dsQMNM---- 280 jewel wasp
XP_973593    238 VYKDKVLVSVITSD------------------------------AVHTRRARNILQEKKPEPKdtq----etKVNP---- 279 red flour beetle
XP_004930585 246 AYDGSVLVTAVTTD------------------------------IVHTRRAIRSVSGNV---------------ELknsv 280 domestic silkworm
EFX72790     213 tYGDRFILTAITNE------------------------------RLRLREKRSTTSNAKANSLrel----ywKLNL---- 254 common water flea
1_pfamImport   1 AYGGQAVVELLSFDSESgnvedv---------------revpvhNIKKRDVA--------SDWitalktarkGYQV---- 53 
XP_003115056 216 SYGGQAVVELLTFDAETgsaeitsen----------reipsdshNIQKRDVS-------IGAFkdalnsarkGFQV---- 274 Caenorhabditis ...
XP_002643585 217 SYGGQAVVELLTFEAESgaaentae-----------dreipsshNIQKRDAA-------ADAYkdiiqnarkAYMV---- 274 Caenorhabditis ...
EGT52551     216 AYGGQAVVELLTFDAETgaeenae-------------sreipthNIQKRDVQ----------YkdvlkaarkSYQV---- 268 Caenorhabditis ...
Q9XTY9       216 AYGGQAVIELLAFEAESgaaekste------------sreipnhNIQKRDTK----------SktptqlareNLQV---- 269 Caenorhabditis ...
CAP20583     185 -TEAVSSDYPAMFAMILGLVGALVVTTIYIIVAMVSIDPEKDSIIYRMTT 233 Caenorhabditis briggsae
XP_001607306 281 -AKNYQSEYSAIFNIILWFGVVFFFSLLAICITIAEMDPGRDSIIYRMTS 329 jewel wasp
XP_973593    280 -AKFYSKDYPVIFNIILWFGVAMTFTLLAICIAIAQMDPGRDSIIYRMTS 328 red flour beetle
XP_004930585 281 dEDGYSADYAAIFNIILWFGVVFTFTLIAIVYALMDMDPGRDSIIYRMTN 330 domestic silkworm
EFX72790     255 -SKRYGSDYSSIFNILLWTSVFLIAALISTAVFICTLDPGRDSIIYRMTT 303 common water flea
1_pfamImport  54 -TVPVSQDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMTT 102
XP_003115056 275 -TVPVSSDYPAIFAIFLGLVVILVIALIYIVVAMASIDPEKDSIIYRMTT 323 Caenorhabditis remanei
XP_002643585 275 -TVPVSTDYPAIFAIFFGLVVILVVALIYIVVGMASIDPEKDSIIYRMTT 323 Caenorhabditis briggsae
EGT52551     269 -AVPVSSDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMTT 317 Caenorhabditis brenneri
Q9XTY9       270 -TVPVSSDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMTT 318 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap