Conserved Protein Domain Family
DUF1641

?
pfam07849: DUF1641 
Protein of unknown function (DUF1641)
Archaeal and bacterial hypothetical proteins are found in this family, with the region in question being approximately 40 residues long.
Statistics
?
PSSM-Id: 400277
View PSSM: pfam07849
Aligned: 77 rows
Threshold Bit Score: 32.3655
Threshold Setting Gi: 74544520
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q96XN2       230 LKEEKIEKItHWWQLLGLLKDPEIQVGLGVVIAVLRHIGK 269 Sulfurisphaera tokodaii
Q4JBU4        75 AGKEEVKDI-KLSEIVRELNDPDVRRGLYLLLKLLKAIGS 113 Sulfolobus acidocaldarius
Q976V7        75 NGKEETGEI-HMADIIRMLNDPDVRKGVYLVLKILKAIGS 113 Sulfurisphaera tokodaii
Q97V14        75 SGKEEAKDI-SLTELTKQLNDPDVKRGLYLLLKILKAIGS 113 Saccharolobus solfataricus
WP_012021264  75 NGDEEVQDV-SLTQILKEFNDPDVKRGLLLVLKILKAIGS 113 Metallosphaera sedula
WP_005223066  87 aTAADSEPP-TLWQLSRQLNDPEVRRGLFFVIQLLGAVGR 125 Marichromatium purpuratum
Q9HIC8        83 NGVKNPQPL-SALKLMALLKDPDVSAFITGLINALKVVVs 121 Thermoplasma acidophilum
Q6KZN9       109 DGTSSGQPI-SIFKLMSMLKDPEISAALNGIFDALKIIGD 147 Picrophilus torridus
EQB69521     111 DGAKQPENF-SLLRLMGMLKDPEVAAGLSAVMNALKTLGS 149 Thermoplasmatales archaeon Gpl
EQB71604     112 DRLKANGPL-GLLKIGSQLKDPDVSAGVRVLLSVARGFta 150 Thermoplasmatales archaeon A-plasma
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap