1HW1


Conserved Protein Domain Family
FadR_C

?
pfam07840: FadR_C 
FadR C-terminal domain
This family contains sequences that are similar to the fatty acid metabolism regulator protein (FadR). This functions as a dimer, with each monomer being composed of an N-terminal DNA-binding domain and a regulatory C-terminal domain. A linker comprising two short alpha helices joins the two domains. In the C-terminal domain, an antiparallel array of six alpha helices forms a barrel-like structure, while a seventh alpha helix forms a 'lid' at the end closest to the N-terminal domain. This structure was found to be similar to that of the C-terminal domain of the Tet repressor. Long-chain acyl-CoA thioesters interact directly and reversibly with the C-terminal domain, and this interaction affects the structure and therefore the DNA binding properties of the N-terminal domain.
Statistics
?
PSSM-Id: 400271
View PSSM: pfam07840
Aligned: 21 rows
Threshold Bit Score: 208.633
Threshold Setting Gi: 197087872
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HW1_A         72 NNFWETSGLNILETLARL-DHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKA-------------------------- 124
Q15S33         72 NNFWETSGLNILETLARL-DEDGISELVDHLLAARTNLSAVFIRGAIRNNQEKT-------------------------- 124 Pseudoalteromo...
tigr:AHA_2443  72 NNFWETSGLNILETLARL-DQDKVPDLVAQLLSARTNICTIFIRGAIRNNPEQA-------------------------- 124 Aeromonas hydr...
Q9CPJ0         77 NNIWETSGLNILEVLVRL-DSTKLPSFISNILSARTNISAIYIQKAFKVEPQKS-------------------------- 129 Pasteurella mu...
P44705         77 NNIWDAAGPNIIETLIAL-DMQSAPLIIDNMLSLRSKMSESYIYEAVKNSPQKS-------------------------- 129 Haemophilus in...
Q7VKY4         84 NDVWETAGPNIISTLIKL-DKSYIPVIIANVVSLRTRMAESYIPEAIKLNPAQC-------------------------- 136 [Haemophilus] ...
jgi:HSM_0971   80 NNIWETAGPNILKTLIQL-SPTLKPTVIANVVSLRTRMGEQFIPEAIKINPQQT-------------------------- 132 Histophilus so...
Q5E4B8         72 NNYMETSGLHILDTLMTLvDANNATSIVEDLLAARTNISCIFMRQAFKTNKEGSlrtlnrviesceqllaaeswdsfiea 151 Aliivibrio fis...
Q87N05         72 NQFMETSGLHILDTLMTL-DVDNATNIVEDLLAARTNISPIFMRYAFKANKENSertiknviescealvnasswddfias 150 Vibrio parahae...
ABM03454       72 NDFWETSSLNVLSTITRL-DIERRADYIDQLMSVRTNVSAIILRMAAKHNTKSV-------------------------- 124 Psychromonas i...
1HW1_A        125 ----QEVLATANEVADH----------ADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLAL 190
Q15S33        125 ----IEILQQYKEVEQD----------GTAFAVKDYQLNHDLAFASGNPVYVLMMNGFKGLYSRIGGYYFSNEKSRALTH 190 Pseudoalteromo...
tigr:AHA_2443 125 ----AEILRGADVVENS----------PEAYAEFDYRLHHQLSFASGNPIYALILNGFKGLYSRVGRYYFSDKQAREAAD 190 Aeromonas hydr...
Q9CPJ0        130 ----LEAFKDLDTLADT----------AEAYTNFDYDLFRKLAFASDNPVYGLILNSLKGLYTRVGLFYFANPSARELAK 195 Pasteurella mu...
P44705        130 ----TALFAELEQLQNT----------AQDYTEFDYQLFRQFTVVANKPFYRLIFNSLKGVYQRIGLLFFKEKKHRELTK 195 Haemophilus in...
Q7VKY4        137 ----CPLFAQLDTLEDT----------AEAYATFDYNLFRQLTFLANKPVYALILNSFKQMYHQVANLFFADPTCRQLSL 202 [Haemophilus] ...
jgi:HSM_0971  133 ----FEFFQSLDELDDD----------EKSYAEFDYNLYHRFSFISDKPVYTLILNSFRTLYHQVAALFFINPQSRQVEL 198 Histophilus so...
Q5E4B8        152 spfgAKIKAEVKEDNEKdpvkreeiliAKTFNYYDYMLFQGVAFKSGNQIYGLIFNGLKKLYARVGSYYFSNSEARELAL 231 Aliivibrio fis...
Q87N05        151 spyaDKVLQSVKEDNEKdeakrqeiliAKTFNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSYYFSNPASRDLAL 230 Vibrio parahae...
ABM03454      125 ----LSFLDKVPSIDAS----------SEEFTEFDYRFYHHVAVSSNNMIYVLILNGLQDLYRRVGYFYFSNTEAKSIAL 190 Psychromonas i...
1HW1_A        191 GFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDL 234
Q15S33        191 DYYQQLLALAEKGDYESVLLVIRNYGIASGKLWNEMRDEMPKGL 234 Pseudoalteromonas atlantica T6c
tigr:AHA_2443 191 AYYKTLLNLAETKNHEAVFMTVRQYGIESGKLWTRLRQDMPSNL 234 Aeromonas hydrophila subsp. hydrophila ATCC 7966
Q9CPJ0        196 RFYLSLKTLCQTQQVNDVKECIRQYGKDSGVIWANMQAYLPANF 239 Pasteurella multocida subsp. multocida str. Pm70
P44705        196 QFYLEMQQICLEGNADAVVDCIRKHNLRSSTYWKAILERLPQNL 239 Haemophilus influenzae Rd KW20
Q7VKY4        203 SFYRLLLSACVEENHEKAIQVLVDNRQLSSEIWVKLLQTLPEQF 246 [Haemophilus] ducreyi
jgi:HSM_0971  199 TFYQQLKECCRNGDYQQASVYLVENRERSSAIWKGILTNLPENF 242 Histophilus somni 2336
Q5E4B8        232 QFYRDLKLICEEERKDAVMPRMRQYGMEGNLIWNEMKLNLPSNF 275 Aliivibrio fischeri ES114
Q87N05        231 RFYRQLLETCETGQREQLPVVIRHYGMESAQIWNEMKKQLPTNF 274 Vibrio parahaemolyticus RIMD 2210633
ABM03454      191 AFYADIKIVLEKGEIHQIMQVVRDSAFASGKIWLHLRHQLPDDF 234 Psychromonas ingrahamii 37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap