4YW7,5ODU


Conserved Protein Domain Family
PA-IL

?
pfam07828: PA-IL 
Click on image for an interactive view with Cn3D
PA-IL-like protein
The members of this family are similar to the galactophilic lectin-1 expressed by P. aeruginosa ((PA-IL). Lectins recognising specific carbohydrates found on the surface of host cells are known to be involved in the initiation of infections by this organism. The protein is thought to be organized into an extensive network of beta-sheets, as is the case with many other lectins.
Statistics
?
PSSM-Id: 369543
View PSSM: pfam07828
Aligned: 2 rows
Threshold Bit Score: 192.544
Threshold Setting Gi: 1258500936
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4YW7_P   1 AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQgliCHDAFCGALVMKIGNSGTIPVNTG 80  Pseudomonas aeruginosa
5ODU_A   3 DWSGSVPANAENGKSTGLILKQGDTISVVAHGWVKYGRDNVEWAAPDGPVPNN---PQPSSIATLVAKIANKKFAIGNGV 79  Photorhabdus luminescens
4YW7_P  81 LFRWVApnnVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS 121 Pseudomonas aeruginosa
5ODU_A  80 LHKTVP---VDGELILLFNDVPGTFGDNSGEFQVEVIIESR 117 Photorhabdus luminescens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap