4N78


Conserved Protein Domain Family
Abi_HHR

?
pfam07815: Abi_HHR 
Abl-interactor HHR
The region featured in this family is found towards the N-terminus of a number of adaptor proteins that interact with Abl-family tyrosine kinases. More specifically, it is termed the homeo-domain homologous region (HHR), as it is similar to the DNA-binding region of homeo-domain proteins. Other homeo-domain proteins have been implicated in specifying positional information during embryonic development, and in the regulation of the expression of cell-type specific genes. The Abl-interactor proteins are thought to coordinate the cytoplasmic and nuclear functions of the Abl-family kinases, and seem to be involved in cytoskeletal reorganisation, but their precise role remains unclear.
Statistics
?
PSSM-Id: 400255
View PSSM: pfam07815
Aligned: 22 rows
Threshold Bit Score: 105.088
Threshold Setting Gi: 1698268208
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4N78_F        94 ISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANL-ERPVRYIRKPIDYTILDDIGHGVKWL 157
XP_023204142  99 IGQTIEMHKEKVARREIGAFTAVRRVPRNHKIIPPTGT-QPRPSYSRRPINYQQLDEIGHGIKVS 162 southern platyfish
CAP28783     103 VNQVVDVHKEKLARREIGALTCNKTLFKQPKIIAPAVQ-EPKIRYQRTPIDFSCLDGIGHGVRIA 166 Caenorhabditis briggsae
Q10929        95 VSQVVDVHKEKLARREIGSLTTNKTLFKQPKIIAPAIP-DEKQRYQRTPIDFSVLDGIGHGVRTS 158 Caenorhabditis elegans
XP_694417    134 lTLTVAMYKEKIARGEIGVLTKQAKVPRTQKVVPPAKGlEPFRGYRRVPISYSCLDKLGHGHWQG 198 zebrafish
EGW01766      93 LSQMVNMHMEKVARREIGTLATVMRLPPSQKVIPPESL-PPLTPYYRKPLNFSCLDDIGHGIKDL 156 Chinese hamster
XP_015217679  97 ISQTVDMHREKVSRREIGVFTTVKRMPRNQKIIPPPATpEQKTKYSRTPIAYATLDSVGHGMKDS 161 spotted gar
AAI24444      99 IGQTVDMHREKVARREIGAFTVGKRVPRNHKVVPPAKNkEAKLKYTRTPISFSSLDSVGHGVKDS 163 zebrafish
XP_013004878  93 LGQMVDMHLEKVARREIGTLAAVQRLYPGQKVIAPSSL-PPLEPYCRRPINFGCLDDIGHGVKvc 156 domestic guinea pig
XP_029700828 102 lSLAVAIHFEKVSRREIGAFTAPKTRIRAKHVTPPASGkEPVRSYSRVPILYSALDSIGHCFQvs 166 torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap