4K6J


Conserved Protein Domain Family
WAPL

?
pfam07814: WAPL 
Wings apart-like protein regulation of heterochromatin
This family contains sequences expressed in eukaryotic organisms bearing high similarity to the WAPL conserved region of D. melanogaster wings apart-like protein. This protein is involved in the regulation of heterochromatin structure. hWAPL, the human homolog, is found to play a role in the development of cervical carcinogenesis, and is thought to have similar functions to Drosophila wapl protein. Malfunction of the hWAPL pathway is thought to activate an apoptotic pathway that consequently leads to cell death.
Statistics
?
PSSM-Id: 400254
View PSSM: pfam07814
Aligned: 62 rows
Threshold Bit Score: 145.524
Threshold Setting Gi: 31340489
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4K6J_A             16 HVKHFNDVVEFGENQEFTDDIEYLLSGLKSTQPL-NTRCLSVISLATKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQ-- 92  
CBI35691          104 ataTLMETQEFGEMMEHVDEVNFALDGLRKGQPA-RIRRASLLSLLSICGTAQQRRLLRTQGMAKTIMDAVIGLSFDDsp 182  wine grape
JCVI:AT1G11060.1  149 FTSTLLEAQEFGELMEHEDEVNFALDGLRKGHQL-RIRRASLSSLLSICASQHQRRSLRAQGISQSIIDAILVLSLDDip 227  thale cress
Q9C951             77 SNSTLMEAQEFGELIENEDEVNFALDGLKKGHKV-RIRRAALSSLLSICESQYQRRSLRALGISQSIIDAILGLCLDDip 155  thale cress
NP_001294626      217 HIKEANELRESGEYDDFKQDLVYILSSLQSSDASmKVKCLSAISLAKKCVSPDFRQFIKSENMTKSIVKALMDSPEDD-- 294  Caenorhab...
EDV26103          227 HVRESHQCLEQGEDEQLADDIEYLLDGLNPSYPK-NLRCSSITALAKRCTESPFRMYIRAHEIIPKILDLLVDSPSDY-- 303  Trichopla...
ETN64005         1018 NVKNSHQMQEIGEFQEMDDDVEYILSALQPDNPV-STRCLSALQLATKCMKPAFKMHVRAHGVVTRFFRALSDAHQDA-- 1094 Anopheles...
XP_015795049      127 RVKKAHQCAELGEREEFDGDIKFYLDGLSRVNNI-NTRCLSILGLANQCQRAEFRMHLRAHDDMPKIISALMDACSNP-- 203  two-spott...
EDO34596          228 NVKKVSECLESGEDQEFFDDVEYLLYGLE-SSKV-STRCLSALDIMSRCTNGSFRVNLRAHGTISKIFNLLKDAGEYK-- 303  starlet s...
XP_019848770      643 NVRQAHECLQHGENLRFRDDVIYLLDSMKTEEPL-LVRCLSTLNLAEQCLNVDFMRQMRSLGLVKKSLLLLKDAQTHP-- 719  Amphimedo...
4K6J_A             93 NLSLCTAALMYILSRDRLN-MDLDRAS--LDLMIRLLELEQDASsakll---------------------nekdmNKIKE 148 
CBI35691          183 S-NLAAATIFFVLTSDSHD-DYLLESPtcIRFLLELLKPPMSNAthgkapsigikllglrkdadplrdtnktidsSSTA- 259  wine grape
JCVI:AT1G11060.1  228 S-NLAAATLFFALTADGQD-EHFMESPkcIKFLIKLLKPVIVTStegkprnigfkllsllkdvdaardpvkmddpSSSD- 304  thale cress
Q9C951            156 S-NLAAATLFFVLTTDGQD-DHFMESPnsIKFLVKLLRPVVSAStkvkprnigsrllsiikdvdaardaasmhdlSSCD- 232  thale cress
NP_001294626      295 LFALAASTVLYLLTRDFNS-IKIDFPS--LRLVSQLLRIEKFEQrpe--------------------------dkDKVVN 345  Caenorhab...
EDV26103          304 QLATYTAALFFVLSEDRLI-MDLTDDL--LDVLLKLLQCPNQDHndtn-----------------------dailKSSLQ 357  Trichopla...
ETN64005         1095 GLALCTAAIMYVFSQDKLN-MDLDRDS--LELMLNLLgttsageqlag-----------------tagkvtndpqQKIRQ 1154 Anopheles...
XP_015795049      204 NLALCTSALMYVYNQDRMT-MDIDPNA--LSLMLELLETR---Tdeee-----------------------dsvdKNYKE 254  two-spott...
EDO34596          304 NLSLCTSAIMYILTQDRQF-IDFDKFI--LEMLIKFISVENSNDvdgse----------------------dieyNKYIH 358  starlet s...
XP_019848770      720 ALKVALVTLSFVMTQSNVEpSELDKKC--TELLVMALSVKDQFLvspageeeppplegkaateykkitdkskallKKCSP 797  Amphimedo...
4K6J_A            149 K-IRRL-CEtVHNKHld---------------------leNITTGHLAMETL------------LSLTSKragdwfkeeL 193 
CBI35691          260 --IVHKvQE-VLVSCkeiksssg---------ddngvgrpELSPKWIALLTMekacfstisledTSGTVRktg----gnF 323  wine grape
JCVI:AT1G11060.1  305 --ILSRvQE-LLVNCkemrlnds---------yitettrpELSTKWVALLAMeracvskisfddTSGSVKktg----gnF 368  thale cress
Q9C951            233 --IIDRaQE-ILVNCkelrlids---------ykiermrpELSTKWVALLVMekaclskisfddTSGTVKksg----gmF 296  thale cress
NP_001294626      346 M-VWEVfNS-YIEKQevggqkv-----------sfdmrkeSLTPSSLIIEAL------------VFICSRsvn---ddnL 397  Caenorhab...
EDV26103          358 N-ISLScKD-YLkah-----------------------vdSLNGKALALACI------------FNLVCSrna----vwL 396  Trichopla...
ETN64005         1155 R-VKELcDE-IKGSGkakphiigsegdsssgsssnssdghRISAATLAMESL------------LSLTSQrag----ewF 1216 Anopheles...
XP_015795049      255 K-VKKLcDE-MKTKGhgkf-----------------lnsnNITAGKLALEAL------------LGLTSKrag----ewC 299  two-spott...
EDO34596          359 R-IKSIlNE-RNRLIpgty-----------------felhDISTFSLARESL------------LSITTErvg----pwF 403  starlet s...
XP_019848770      798 LlIHAKySD-SSNTNetvdi---------------slqpsTLSLGELATECF------------LSLTSSmnts--vssL 847  Amphimedo...
4K6J_A            194 R----LLGGLDHIVDKVKECVdhl----------------srdEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIaY 253 
CBI35691          324 KekfrEFGGLDAVFEVAMNCHstlegwlk------hgspsirdAKDDANLQSLVLLLKCLKIMENAAFLSKDNQSHLLgM 397  wine grape
JCVI:AT1G11060.1  369 KeklrELGGLDAVLEVVMDCHavmerwve------ydalsvqeKKDNLHKQSLMLLLKCLKIMENATFLSTDNQNHLLgF 442  thale cress
Q9C951            297 KeklrELGGLDAVFDVVMDCHtvmeswvt------hdtlsvedIKDDLNKQSLMLLLKCLKIMENATFLSTENQIHLLrL 370  thale cress
NP_001294626      398 KsellNLGILQFVVAKIETNVnli-----------------adNADDTYS--ILILNRCFRILESSSVFHKKNQAFLIsH 458  Caenorhab...
EDV26103          397 KdkvrSIGILDVICDLVIDHKynl-----------------emNPKANRIIVLREVELCCRILETVTFLNKENQDYVIgW 459  Trichopla...
ETN64005         1217 KdelrKLGGIEHLIKTVSECYesvpe------------raadwHPEAIAK--LRKIERCLRVLNNVCVFNRANQAFLLeH 1282 Anopheles...
XP_015795049      300 KeelrNLKGIDFLCNKTIDESnslir------------ddivwEEEIVDKGLLHKIERTLKVIENVTFMNQENQNYIIeY 367  two-spott...
EDO34596          404 KeevrSLGALDHIIDTISESVnwvieek---------gsipegDQNMQAK--IIRIDKCLKLLENVTYQNTSNQTYLLhY 472  starlet s...
XP_019848770      848 KedlrTLGAIDVIANRAIALTrqctgyltsgqeeegkeeeereGEEREVDVHFMKLFRQLKLLENILCMSKGNQSYLTmF 927  Amphimedo...
4K6J_A            254 KDSQ------------LIvSSAKALqhceeliqqynraedsicladskplphqnvtnhvgkavedcMRAIIGVLLNLTND 321 
CBI35691          398 KGKGncngsrlsfiklIL-SIIKTL---------------------------------------------SGLSLSKSSS 431  wine grape
JCVI:AT1G11060.1  443 KKCLgshdsrmsftelTI-SVIKML---------------------------------------------SGLHLRGGFS 476  thale cress
Q9C951            371 NKSMgshesrlsftelMI-SVIKIL---------------------------------------------SGLQLR---- 400  thale cress
NP_001294626      459 RSNIl-----------IS-SLAKFLqvildrvhqlaee--------------------evkkyisclalmCRLLINISHD 506  Caenorhab...
EDV26103          460 KGYTl-----------VG-NVSRIFslcvekimsqdkn-------------------tainedsacllasVRLLLNITHE 508  Trichopla...
ETN64005         1283 RDGLl-----------VQ-LLARIYrqldreipfhptddht-------------pkeavgvvvrelhqpiLHMLITLTHS 1337 Anopheles...
XP_015795049      368 QGGKf-----------IY-RCIDLIkylknsiifmte----------------------sqsqlstllsiLRVLTNLTSE 413  two-spott...
EDO34596          473 QKGLl-----------AR-SLSRSLikihlikptycttrk----------------aslpghsagsllnaFKLFLNLSND 524  starlet s...
XP_019848770      928 DGSIf-----------IS-EISKFLvllgdyliskdl------------------strhtcivtetLLGTLRVFLNITHD 977  Amphimedo...
4K6J_A            322 N-----EWGSTKTgeQDGLIGTALNCVLQV-PKYLPQEQRFDIRVLGLGLLINLVEYSARN 376 
CBI35691          432 TisideKSRNISDgiSHDSQVDCMADYKGTv------TDS----VCVLESNGNLFVnysrk 482  wine grape
JCVI:AT1G11060.1  477 SpntnnVNSHYSNggNHDSVLEANRKVTNEvVTISSDTYS----TVGSISTRNGSVSQRSQ 533  thale cress
Q9C951            401 --------AHRNEkhPHPQPHLASAVKKGFvTIISSDTCS----TTGFSSIKSLSVSKRNQ 449  thale cress
NP_001294626      507 N-----ELCCSKLgqIEGFLPNAITTFTYLaPKFGKENS-YDINVMMTSLLTNLVERCNAN 561  Caenorhabditis elegans
EDV26103          509 N-----EIGCKQVgrDKSTIKAAMECIDEI-HEKVDDVRRFDLVILALGLLINLVESNKES 563  Trichoplax adhaerens
ETN64005         1338 Fdd--qAPGATLVgqQPEMIDITMQILLRI-ARYVPSRCVFDLNLLALTLLLHLARPSEQN 1395 Anopheles darlingi
XP_015795049      414 S-----SEGCFKVgsFTGLFQLLLECLFEL-PSFTVPDSRFDLIVLLLCLEINFVEYCVNi 468  two-spotted spider mite
EDO34596          525 S-----EEGSNLIgqQEGFLSTLLFSVLQL-PQYYEASQRFDLHVLGLGLLINLVEHSKQN 579  starlet sea anemone
XP_019848770      978 N-----ALASYRVgeQEKIIDSICNFTFKL-AQSVPVIQQFDILVLCLSLLINLLEESSTN 1032 Amphimedon queenslandica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap