Conserved Protein Domain Family
TMC

?
pfam07810: TMC 
TMC domain
These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 and EVIN2 - this region is termed the TMC domain. Mutations in these genes are implicated in a number of human conditions, such as deafness and epidermodysplasia verruciformis. TMC proteins are thought to have important cellular roles, and may be modifiers of ion channels or transporters.
Statistics
?
PSSM-Id: 400250
View PSSM: pfam07810
Aligned: 90 rows
Threshold Bit Score: 102.602
Threshold Setting Gi: 260793044
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015788900  884 CWETMFGQELAKILVADTLLGIVITIVADYGRALFVRYCNDCscifwdLETQFPgYSDFQIAENILSLVNNQANIWLGMF 963  two-spotted s...
XP_019687352  499 CWETYVGQEMLKLSIIDMLFTVASILLIDFFRGLFVRYLSDYwc--wdLESKFPeYGEFKIAENVLHLVYNQGMIWMGAF 576  domestic cat
XP_014347310  628 CWETMVGQEFVRLTVSDTMTTYITILIGDFLRAVFVRFFNHCwc--wdLEYGFPsYSEFDISGNVLGLIFNQGMIWMGAF 705  coelacanth
ELK04029      520 CWETAVGIEFMRLTVSDMLVTYITILLGDFLRACFVRFMNYCwc--wdLEAGF--------ANQVCGFCPSR----MGSF 585  black flying fox
EEN49741      174 CWETIVGQEMYKLSVFDMIATLVTTIIVDFLRGLFVRFANYCwc--wdLEAKIPgYGEFGVAENVLHLIYNQGMIWMGAF 251  Florida lancelet
CAP24545      481 CWETIIGQEIVKLVTMDLIFTILSILVIDFLRGLWIKYCSSWwc--wdIETTFPeYGEFKVAENVLHIINNQGMIWLGLF 558  Caenorhabditi...
NP_001335566  294 CWETIIGQEITKLVTMDLYMTVASIFLIDFLRGLACRYLNLYwp--wdLERTFPeYGEFKVAENVLHLVNNQGMIWLGLF 371  Caenorhabditi...
XP_021081903  556 CWETAVGIEFMRLTVSDMLVTYLTILVGDFLRACFVRFMNHCwc--wdLEAGFPsYAEFDISGNVLGLIFNQGMIWMGSF 633  golden hamster
XP_022523557  580 CWETTVGIEFVKLTVSDIQVTYLTILIGDFLRAMIVRFLNYCwc--wdLEAGWPsYGEFDISGNVLGLVFNQGMIWMGAF 657  Mexican tetra
XP_018670245  487 CWETYVGQELMKLSVIDLISTLLTILIVDFIRALFVRYVNRCcc--wdMESQFPeYGEFKIAENVLHLIYNQGITWVGSF 564  vase tunicate
XP_015788900  964 FSPGLPGINTIRLCILMYLQSWAVLTSNIPHETVFKAS 1001 two-spotted spider mite
XP_019687352  577 FSPCLPAFNVLKLIGLMYLRSWAVLTCNVPHQQVFRAS 614  domestic cat
XP_014347310  706 YAPCLPAINVLRLHTSMYLQCWAVMCCNVPHERVFKAS 743  coelacanth
ELK04029      586 YAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKAS 623  black flying fox
EEN49741      252 FAPCLPVLNVLKLIALMYLRSWAVIMCNTPHQRVFRAS 289  Florida lancelet
CAP24545      559 FAPLLPAINNIKLIILMYIRGWAVMTCNVPAREIFRAS 596  Caenorhabditis briggsae
NP_001335566  372 FVPLLPMLNNIKLIILMYIRGWAAMTCNVPASQIFRAS 409  Caenorhabditis elegans
XP_021081903  634 YAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKAS 671  golden hamster
XP_022523557  658 YAPGLVGINVLRLLTSMYYQCWAVMACNVPHERVFKAS 695  Mexican tetra
XP_018670245  565 FCPVLPTINVIKLTLMMYVRSWAVVTCNVPHQRVFRAS 602  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap