Conserved Protein Domain Family
DUF1647

?
pfam07801: DUF1647 
Protein of unknown function (DUF1647)
The sequences making up this family are all derived from hypothetical proteins expressed by C. elegans. The region in question is approximately 160 amino acids long. The GO annotation for this protein indicates the protein to be involved in nematode larval development and to have a positive regulation on growth rate.
Statistics
?
PSSM-Id: 369527
View PSSM: pfam07801
Aligned: 32 rows
Threshold Bit Score: 173.94
Threshold Setting Gi: 341875937
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003110375  142 CYCKSESSGKNYNFCYVDPQNSSSIGKQFDCVHVNTLERLsklwfifgnycflsEVLNY-PKPLPIVSELIEIEEDVVFV 220  Caenorhabditi...
EFO94280       65 CACKSTVTGKIYDFCYKLPENPKTIGKRFDCKYVDDWERVgnqfifdlpypdhaHFPES-PSKFIDLHT--EAAPEPVFV 141  Caenorhabditi...
Q9XV45         61 CGCKSTVTGKLYDFCYKLPEDEKSIGKKFDCKFVEEWEKI-----------------ES-STKFVDLQN--DSLPEPVFV 120  Caenorhabditi...
EGT31872       64 CACRSNVTGKIYDFCYKLPEDHKKVGKRFDCERVEDWERI-----------------ES-ESKFIDLKT--ENAPEPVFV 123  Caenorhabditi...
EFP10720       71 CECISKKTQKSYDFCYKNPKNSSLIGRRFNCSYLKILEDL--------------KLVDApDQSLVNLANPDRNET--IFV 134  Caenorhabditi...
EGT31112       99 CECVSNKTKKSYDFCYRNPKNSSLIGKRFDCTHLDALEEL--------------KLLDFsDQSLVDLSNPNRDASDVMFV 164  Caenorhabditi...
EFP00144       98 CECISSRTRKSYDFCYRNPKNPSLIGKKFNCSYVSALEDL--------------KLIDSsEQSLVDMTKAERNEKDVIFV 163  Caenorhabditi...
Q9TXY5         58 CECVSNQTNKSYDFCYRNPRNESLVGKRFNCDWLSTLEDM--------------KLVDApDQEMVDMSNPSRNESDVIFV 123  Caenorhabditi...
CAB03854       64 CECVSSRTRESFDFCYKNPKNVSLVGKRFNCTWLSILEDL--------------KLIGShEQIMVELKRPVKNDSDIMFV 129  Caenorhabditi...
Q9N4X7         68 CECISSWTGKSYDFCYRNPKNATLVGKRFNCTWLSTLEDL--------------KLVGLhEQSLVDLYEYEKNDSDVIFV 133  Caenorhabditi...
XP_003110375  221 STTSDDHYSHSSKSYESVRNYYPTHKYILYGLHLSPGYVAQLPn-dTNFEFRQFNTSEYPEYVNHWVEYRFKPLIMA 296  Caenorhabditis r...
EFO94280      142 TAFNNPFFRNGERLISSIRKLGFHNKIVLYDLGISKEHLEILRnkaCNLEIRYFNFTNYPDYVKNLKSYRWKAIAIA 218  Caenorhabditis r...
Q9XV45        121 TAFNNPFIRNGKRLISSIRRLGFHNKIILYNLGIEKENLKALEn-sCILEIRHFNFTKYPGYVRNLKSYRWKPIVIA 196  Caenorhabditis e...
EGT31872      124 TAFSDSFVNNGKRLISSIRELGFHNKIILYDLGIKKDNLELLQekaCALEIRSFNFTKYP-FEKDLRSYRWKPIVIA 199  Caenorhabditis b...
EFP10720      135 SAISDNHFGNFKEMYKLIKQHWPNQKVILYSLELSAIYIKKLKt-eRNVEVREFDTSKYPKHVKNWAEYRFKALILA 210  Caenorhabditis r...
EGT31112      165 SAISMNHFGNFKEMYALIKKHWPQQKLVLYSLDLPDIRIKELEa-dPNIQVKKFNYSKYPKYVENWAEYRFKALILA 240  Caenorhabditis b...
EFP00144      164 SAISSNHFGNFKEMYATIKRHWPMQKMLLYSLDLSESQIETLGk-ePSVEIRKFDYSKYPKYVQNWAEYRFKALLLA 239  Caenorhabditis r...
Q9TXY5        124 SAISSNHIGNFNQMNKLLIQHFPHQKVLLYSLDLSDNELETLD---KNVIIRKFNYAKYPNYVRNLKEYRFKALILA 197  Caenorhabditis e...
CAB03854      130 SATSKNHLFNFNEMYNIVHRNWPNQNMILYSLDLTDAQILDIEk-rPTVKVRKFDYSKYPNYVENWMEYRFKALILA 205  Caenorhabditis e...
Q9N4X7        134 SATSRDHLANFNSMYAIVKHHWPRQKLILYSLDLTDKDILDIEk-ePNVKVRKFDYSKYPKYVKNLMEYRFKALILA 209  Caenorhabditis e...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap