Conserved Protein Domain Family
DUF1640

?
pfam07798: DUF1640 
Protein of unknown function (DUF1640)
This family consists of sequences derived from hypothetical eukaryotic proteins. A region approximately 100 residues in length is featured.
Statistics
?
PSSM-Id: 400241
View PSSM: pfam07798
Aligned: 97 rows
Threshold Bit Score: 119.15
Threshold Setting Gi: 1780840933
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF49413            307 FDTHGFVKRLES----GGWIsnaakaqrlaasskpgkgkqaqnesgsqelglqiaqrHDPAEAIMEGVRHLITTRGRQLA 382  Ustilag...
EHK41366             34 FDTYSLVKQLHE----GGYS-------------------------------------SDQATTMMKAVRALLAHNLDMAQ 72   Trichod...
CCT66261            162 FDTYSLVKQLQE----GGYT-------------------------------------QEQATTSMKAIRTLLAENLEIAQ 200  Fusariu...
WGS:ADNJ:MAA_06044  194 FDSYSLVKQLEE----GGYS-------------------------------------REQAVTSMKAIRKILGQNLDVAQ 232  Metarhi...
XP_006667070        229 FDSYSLVKHLEVe---GGYT-------------------------------------TQQAIMSMKAIRKLLAKNLHVAQ 268  Cordyce...
XP_001908096        244 FDSYSLVKHLSSpdqpPKYT-------------------------------------LPQSIALMKAIRALLAHNLDSAQ 286  Podospo...
XP_003655476        222 FDSYTLVKQLTA----GGYT-------------------------------------LPQAILAMKAIRTLLASHLDVAQ 260  Thermot...
XP_002143025        183 FNTYQVFDELKE----GGFD-------------------------------------DEQAHQMVGIIGDMVKYKIGDIL 221  Yarrowi...
EEQ38631            110 IDTYEVYKQLTR----AGFT-------------------------------------AEQSNEIIDLLVYQLNTKLSKLS 148  Clavisp...
XP_001528547        167 LDTYSVFSKLKE----AGFT-------------------------------------DAQADSIIYLLIYQLNSKLSKLS 205  Loddero...
CCF49413            383 HACLNKSDVENQTYLFKAALSEIRTEVQVRGRNDAAGLRSITTLLQREVDALEQKMKEDVERLKHDIQVDMNNRKAESKE 462  Ustilag...
EHK41366             73 EKLVSKSDVENESYLFSAACSELSAEIKNNRRAQDEQIRQQRTHLQHEVDILTQTLNQELLTLNDNVRGAFNDRKMTVRE 152  Trichod...
CCT66261            201 STLVSKSDVENETYLFTAACSELSTEIKNNRRLEEEQLRQQRTHLQHEVDILTQSLNQEVHTLNDNVRGSFNDRKMAVRE 280  Fusariu...
WGS:ADNJ:MAA_06044  233 KSLVSKSDVENETYLFQAACSELSTEIKNNRRLQEEEMRQQRTHLQHEVDILTQSLNQELLTLNDAVRGLFNDRNMAVRE 312  Metarhi...
XP_006667070        269 QSLVSKSDVENETYLFSAACSELNTEVKNNRRIAEEELRQQRTHLQHEVDILTQSLNQEVATLNDTVKGMYNDRKQAVRE 348  Cordyce...
XP_001908096        287 SGLVSRSDVDNETYLFRAACSELSTEVRKNRRVADEQLRQQRTHLQHEVDILTQRLNQDLLTLTDSVRGMFNDRKMAVRE 366  Podospo...
XP_003655476        261 AGLVSKADMENESYLFRAACSELSAEVRNNRRVADEQLRQQRTLLQHEVDILAQRLNQELLTLNDSVRGMFNDRRMAVRE 340  Thermot...
XP_002143025        222 ENYFPMLDSDNEAYLFEAACSELRTEVQKMREADVNERQLEIDSFQKDMEEFEQDVNSLLIDMRNNIDILLSERKNENDE 301  Yarrowi...
EEQ38631            149 TKYSQIYELENEQYLFESAQQELRVDITRNREQHINDAVTKINALETDYEVISDELNNHFIQMKNDVQVAINDQKSDNTL 228  Clavisp...
XP_001528547        206 TIYAQQYELESEQYLFESAQQEIRVDITRSREQHINELITLVNILERDFNIITDELNNDYLKLKNDSQVAINEQKSENTL 285  Loddero...
CCF49413            463 EQNNLEQEIQDLNNRFTISL-SDLKTEIEqNVKWDATRRSL-FLVFGIAAIVAAN---L 516  Ustilago hordei
EHK41366            153 EQKGADSAIQQITYKISIMLsSDSKSEIE-GVRWILIRRSV-VGILFMAIVTLGT---I 206  Trichoderma atroviride IMI 2...
CCT66261            281 EQKSVESSIQQINYKISIVLsSDAKSEIE-AVRWILIRRSV-LGILFMAVLTLGT---L 334  Fusarium fujikuroi IMI 58289
WGS:ADNJ:MAA_06044  313 EQKSVESAIQKINYKMSILLsSDSKSEIE-GVRWVLIRRSV-VGLVFLAILTLGM---I 366  Metarhizium robertsii ARSEF 23
XP_006667070        349 EQKAMDSAIQKISYKISIDLtSDAKTEIE-GVRWVLIWRSV-LGIVVMAFLTLGT---L 402  Cordyceps militaris CM01
XP_001908096        367 EQKAVESRIQQINYKISVMLnSDSKSEIE-EVRWVLIRRSV-LGILFMAVLTLGT---L 420  Podospora anserina S mat+
XP_003655476        341 EQKAVESRIQQINYKISVTLnSDAKSDIE-ALRWVLIRRSV-LGIIFMAVLTLGM---L 394  Thermothielavioides terrestr...
XP_002143025        302 VLKHTDIRIQEVNNSIVVDAnHRMKPVIE-EFRWVLMRNGL-FLIFSVAVMLLGTl-yL 357  Yarrowia lipolytica CLIB122
EEQ38631            229 KSKKIMLRIQETNHKITTELnMAMRSEIE-SLRWHLSRWGLiAIMASVCASSVTIyvyr 286  Clavispora lusitaniae ATCC 4...
XP_001528547        286 NVKKLFLRIQETNHKITTELdSAIRSEIE-SLRWYLSRWGL-----------ITLlvsL 332  Lodderomyces elongisporus NR...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap